(data stored in ACNUC16935 zone)

EMBL: BN001307.PE200

BN001307.PE200       Location/Qualifiers
FT   CDS_pept        join(564859..564952,565122..565184,565294..565333,
FT                   565424..565478)
FT                   /locus_tag="ANIA_11633"
FT                   /old_locus_tag="AN11633.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007986"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007986"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007986"
FT                   /db_xref="GOA:C8VLT6"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT6"
FT                   /protein_id="CBF84738.1"
FT                   /translation="MLLYPPTFVLGRWSRPAAVLRTSGIHALTFERFLFPAIEGHWAYC
FT                   DSQNIAFPSREPYGLDSPDMKRWQQTYVISLDEIRQCD"
     atgcttctat atcctccaac tttcgtactt ggtcgctggt ctagacctgc ggccgttttg        60
     cgaacgtcag ggattcatgc tctgacattc gaaagatttt tgttcccagc aatagaagga       120
     cactgggctt attgcgattc tcaaaacatc gcatttccat cgcgggagcc ctatggactt       180
     gactcgccag atatgaagcg gtggcagcag acctacgtta tttcattgga tgagatccgt       240
     cagtgcgact aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page