(data stored in ACNUC16935 zone)

EMBL: BN001307.PE201

BN001307.PE201       Location/Qualifiers
FT   CDS_pept        join(566404..566464,566530..566549,566685..566772,
FT                   566829..567250)
FT                   /locus_tag="ANIA_08883"
FT                   /old_locus_tag="AN8883.4"
FT                   /product="RNA binding protein Tma22, putative
FT                   (AFU_orthologue; AFUA_8G02730)"
FT                   /note="transcript_id=CADANIAT00007987"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007987"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007987"
FT                   /db_xref="GOA:C8VLT7"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT7"
FT                   /protein_id="CBF84739.1"
FT                   /translation="MAEVSQPPAETQARQITYCGVCTLPPEYCEFGGTAKKCQEWLKDN
FT                   RLEEYQRLYSDEAISANLSTLSVSVQERAAKDAAKKEAKAAAAEARDAERRATSKVQIK
FT                   RVERNKRKHVSVVTGLEVYGLENKKVAKELGKKFATGSSVTKSASGIEEITVQGDVCED
FT                   IKEWLLENYGKGISESNIEIVEDKKKKKGTAEA"
     atggcagagg tctcgcagcc acccgcagaa acccaagctc ggcaaatcac atattgtgga        60
     gtttgcacat tgcctccaga gtactgtgaa tttggcggaa cggcgaagaa atgtcaggag       120
     tggctgaaag ataaccggtt ggaagagtac cagcggttat actctgatga agctataagt       180
     gcaaatctct ccactctgtc agtctccgtt caagagcgcg cagccaagga tgccgcaaag       240
     aaggaagcga aggcggcggc ggcggaagcg cgggatgcag agcgtcgagc gacatctaag       300
     gtccagatca agcgtgtcga gcggaacaag cgcaaacatg tcagtgttgt tacaggactc       360
     gaagtctacg gattagagaa taagaaggtg gccaaggagc tgggaaagaa atttgcaaca       420
     ggttcgtccg tcacgaagtc tgcttctggc attgaggaga tcacagtgca aggcgatgta       480
     tgtgaggaca tcaaggaatg gttattggaa aactatggga agggaatttc ggaatctaat       540
     atcgagattg tcgaggataa aaagaagaag aaggggacag ctgaagctta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page