(data stored in ACNUC16935 zone)

EMBL: BN001307.PE202

BN001307.PE202       Location/Qualifiers
FT   CDS_pept        complement(join(567382..568099,568143..568426))
FT                   /locus_tag="ANIA_08882"
FT                   /old_locus_tag="AN8882.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007988"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007988"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007988"
FT                   /db_xref="GOA:C8VLT8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT8"
FT                   /protein_id="CBF84741.1"
FT                   /translation="MHHVSSRADGRGSISTYQQQESEEDGMLRPSARENTQSRWGSVST
FT                   GLESRRDSVFYGIDKDIRLGSIKRPEEIHSMDDLQRVRDLRSRGEQYVILYLRSALSAV
FT                   GTLATDITRRLDYTYYGLLEKIAALTMTIVSLQELSDTTSKLFDDFQQETTGLEHDIRK
FT                   QIGDLHEFQPQVQRIEALEERMRASKTRAKALSNRLDAMRSEIERWDKREMEWQMRTNQ
FT                   RLRIFWGIITSVILAALVFIILQHWPSEETSSGFKALPRSLKLTNNPSHIPHPKENDAF
FT                   SPSSRSEYAMTLESSNLDGTTSTVQKDPSTSVGADKATRSADYDPLRIFDEL"
     atgcatcatg tttcgtcaag agcagacggc agaggctcaa tatcgacata ccaacaacaa        60
     gagagtgaag aagatggaat gcttcgacct agcgcacggg aaaacactca atcgcgttgg       120
     ggctcggtat ctacaggtct cgagagcagg agagatagcg tcttttatgg tattgacaag       180
     gatatccgtc tcgggtcaat caaaagaccg gaggagatac attctatgga tgacttacag       240
     cgagttaggg acctacgaag cagaggagaa cagtatgtta tactatacct gcgttctgca       300
     ctgtccgcag ttgggacgct tgcaacagac attacacgac gactggacta cacctactac       360
     gggcttctgg agaaaattgc agctctcact atgacaatcg tctcccttca ggagctatca       420
     gatacgacgt ccaaactttt tgacgacttc cagcaggaga ccacaggctt agagcacgat       480
     atccgaaaac aaatcggtga tctccatgaa tttcaacccc aggtgcagag aattgaggct       540
     ttagaggaac ggatgagagc cagcaagaca agggctaaag cgctcagcaa taggctggat       600
     gcaatgagga gtgagattga aagatgggac aagcgggaga tggaatggca aatgcgaaca       660
     aaccaacgac tacgtatttt ctggggcatt atcacatcag ttatcctagc agccctggtt       720
     ttcatcatcc tccagcactg gccgagtgag gagacatcgt ctggctttaa agctcttccg       780
     agatccttga aactcacaaa taatccctct cacattcctc accccaagga aaacgacgca       840
     ttctcaccaa gctcgaggag cgagtacgcg atgactctag agtcatccaa cctcgatggc       900
     acgacaagta cggttcagaa agatccatct acatcagtcg gggctgataa agctacaaga       960
     tcggccgatt atgacccttt acgaatattt gatgaattat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page