(data stored in ACNUC16935 zone)

EMBL: BN001307.PE203

BN001307.PE203       Location/Qualifiers
FT   CDS_pept        complement(join(569467..569607,569678..569823,
FT                   569904..569961))
FT                   /locus_tag="ANIA_11145"
FT                   /old_locus_tag="AN11145.4"
FT                   /product="rRNA-processing protein cgrA
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9Y708]"
FT                   /note="transcript_id=CADANIAT00007989"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007989"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007989"
FT                   /db_xref="GOA:Q9Y708"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y708"
FT                   /protein_id="CBF84743.1"
FT                   /translation="MSSAAPAPSTHAAKSIRKNGKNWHDNKKPFRPNGGLTSYTKRAAA
FT                   RKEQEAIKEYEKELREEREAERQAHIQRIKERRAAKEEKERYEKMAEKMHRKRVERLKK
FT                   REKRNKLLNS"
     atgtcgtccg cagctccagc accctcaacc catgcggcca aatcaatacg caagaatggt        60
     aaaaactggc atgacaacaa gaagcccttc aggcccaacg ggggtttaac ctcgtacaca       120
     aaaagagcgg ctgcgcggaa agaacaggag gctattaagg agtatgaaaa ggaattgaga       180
     gaggaaagag aagcagagag acaggcgcac atccaaagaa tcaaagaacg cagagccgcg       240
     aaggaagaga aggagcgata tgagaaaatg gccgagaaga tgcatcgcaa acgggtcgag       300
     cgactgaaga aaagagaaaa acgaaacaag ctcctcaact cttga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page