(data stored in ACNUC16935 zone)

EMBL: BN001307.PE204

BN001307.PE204       Location/Qualifiers
FT   CDS_pept        join(570534..570644,570699..571568)
FT                   /locus_tag="ANIA_08881"
FT                   /old_locus_tag="AN8881.4"
FT                   /product="Mitochondrial carrier AMCAPutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8X1Z8]"
FT                   /note="transcript_id=CADANIAT00007990"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007990"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007990"
FT                   /db_xref="GOA:G5EB14"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB14"
FT                   /protein_id="CBF84745.1"
FT                   /translation="MAATESALTIHNDISMELPELAPNQGLEAFKDIVFGSAAGMIGKV
FT                   IEYPFDTVKVRLQSQPDHLPLRYNGPLDCFRQSFQAEGLRGLYRGISAPMAGAAVENSC
FT                   LFFSYRVVQELLQASYYSSTEPLPLTALVFSGAASGSITSLALTPIELIKCKMQVPSEP
FT                   SSARVGPLKIIVSVFRQDGVLGFWRGQLGTLIRETGGGAAWFGGYEGVSALFRSYHYSP
FT                   STTFSSEVESGSLPLYQQMLAGAAAGVSYNFLFYPADTIKSRLQTEDINNTSSKRQTFG
FT                   GAARALWHQQGLRGLYRGCGITCARSAPSSAFIFTVFEGLRSYFG"
     atggcggcta ccgaaagtgc gttgacgata cacaatgata tctcaatgga gctgcctgaa        60
     ctagccccca atcaaggtct agaggccttc aaagatattg tttttggatc agctgcagga       120
     atgataggca aggtcattga atatcccttt gacacggtca aggttaggct tcagtcacaa       180
     ccggatcacc ttcctctccg atacaatggg ccgttagatt gtttccgtca gtcattccag       240
     gcagagggtc ttcggggtct ctatcgggga atcagcgctc cgatggcggg agctgctgta       300
     gagaacagct gcttgttctt cagttaccgt gtggttcaag agctacttca ggcctcgtac       360
     tattcctcga cagagccgtt accgttaact gctttggtgt tcagcggtgc tgcatccgga       420
     tccatcacct cccttgcctt gacaccgatc gagctcatca aatgcaagat gcaagtgccc       480
     tcggagcctt ccagcgcacg agtgggaccc ctcaagatta tagtctctgt tttccgccag       540
     gacggcgtct tggggttctg gcgcggccaa ctgggtacgc ttatccgtga gacgggcggt       600
     ggtgctgcgt ggtttggggg ttacgaaggg gtgtcagcac ttttccgttc ataccattat       660
     tcaccttcga caaccttttc ctctgaggtc gaatctgggt cactccctct ttatcaacag       720
     atgttggccg gagcagcagc cggtgtcagc tacaatttcc tcttttatcc agccgacaca       780
     ataaagtcga gattgcagac agaagatatc aacaacacat ctagcaaacg acagacattc       840
     gggggcgccg ctagggctct ctggcatcag caaggacttc gcggcctata tcgaggctgt       900
     ggtatcactt gtgcgcggtc tgcgccaagc tcggcattca tttttacagt atttgaaggc       960
     ctacggagtt actttggatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page