(data stored in ACNUC16935 zone)

EMBL: BN001307.PE206

BN001307.PE206       Location/Qualifiers
FT   CDS_pept        complement(join(573136..573772,573824..577599))
FT                   /locus_tag="ANIA_08880"
FT                   /old_locus_tag="AN8880.4"
FT                   /product="vacuolar protein sorting protein, putative
FT                   (AFU_orthologue; AFUA_8G02780)"
FT                   /note="transcript_id=CADANIAT00007992"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007992"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007992"
FT                   /db_xref="GOA:Q5AS50"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AS50"
FT                   /protein_id="CBF84749.1"
FT                   /translation="MIPRWIQLVGCLLLALMLPPSAAKKDKPGISFHKLHEKPYSMFYF
FT                   EKSDTVLLNLEDGEVLRSFDAGENWEVIEDNGMKHGVTSIHQHPFDEDKAYALGDDGKH
FT                   WITTDKAKTWKSFKVPDQAYFKSPQTGPLTFHGRDSSKVIFETRPCPSCAPRSYYTTDD
FT                   FDTIEVLTESAVGCYWAVGNPQFAAGPNMPKGMEERTVCVVPGLKASSRFAFRLVYSDD
FT                   YFRSQGIETKLQDGRPVSGVTSIAQVKSFIVAAVESQGTTERALYVTTDIEKWHRAEFG
FT                   DHRLEQDAYTVLESSDYSLQVDVLTNPFSGMGVLFTSNSDGTYFTRNIEHTNRGPRGYV
FT                   DFEKLAAIQGIVLVNTVRNPDDVEAGASKEVVSQISFDDGRTFQPLKSTDGQRIHLHSV
FT                   NSDTNLGRVFSSPAPGLVMGVGNTGDYLGKRSDGHLYVSDDAGLTWRLALKGPHKYEFG
FT                   DQGAVLVAISEAPKVKKIEYSLDHGKEWKSVDLPHEVDGETSTLTTTPDSTSLKFILLG
FT                   HSKGEPSVYAIDFEDLHERKCEDEDFDNHWPARLDEHGEPDCLMGQKQFFRRRKANADC
FT                   FVAEAFNSSMSKFEPCKCTVEDFECQSTRTEDGKDCVPPKSFTPPDGDCINPDDTTMIP
FT                   SGWRLIPGDVCVRDDGVNLDKDVEIPCKDVNNRPKSKEITSTMKMFSSGLSAYRYLERQ
FT                   VSNLGEDETVLMLSRNQELFVSHDHGQTWQQELKGASIMKIVPHPYNSDTAYILTDSEE
FT                   VFYTINRGATFGSFRAKTLPDYENGPILRFHPLKRDWLLWVGTECDSGSCHSNAYFSDD
FT                   RGDSWKTILRHAKKCEFEYKENRPDSLYLVFCEQYENEDDKKRLQLMSTTDERFSDWET
FT                   VEENLVEYATRAEYIILASHTDKDNALKARVSVDGTTFADLKFPPNVVPAQNLYTLVDA
FT                   SEHAIFLYVGGSNNTGSLIKSNSNGTTYVLSLDAVNQNDWGYVDFERMQALEGVIIANI
FT                   VSNVDELSDGAPKRLRTMITHNDGGEWTLLAPPTKDANGKKFPCSVVEGKGTEDCALHL
FT                   HGYTERADPRDTFSSGSAIGLMMGLGNVGDRLTSKDEADTFLTMDGGITWKSVKKGRYM
FT                   WEYGDSGSVIVIVSEQKSTKVLHYSTDEGATWQDYYFSDEEIEVIDISTVPSDTSKKFI
FT                   LWGKKSDELVTVNVDFSGLYDRDCEFDDKGGDVSDDYQLWTPKHPFQEENCLFGHVEQY
FT                   RRKKPSAECWNNWRGPHLHSIQRNCTCTTADYECDYNYERQNDGTCKLVPGLKPHDPVG
FT                   YCKAHPDAIEYFEPTGYRRIPQTTCQGGYNLDHQTAKPCPGKQQEYDKKHGISGIGLFF
FT                   AIVAPIAVAGAVGYYIYTKWDGKFGQIRLGETSTGTQGILSRDSLLVTVPIAIIAGIVA
FT                   VAKALPLLVTSLWRSASGYMRVGNRSYPRPYASRASFAARRGDYSSVVEDEDELLGVVD
FT                   FDGDEEEDS"
     atgatacccc gatggattca gctggtgggc tgcctattac tggcgctcat gttgccgccg        60
     agcgctgcga agaaagacaa acccggcata tctttccata aactccacga gaagccgtat       120
     tctatgttct atttcgagaa gtctgatact gttttgttaa atttggagga cggagaagtt       180
     ctacgttcgt ttgacgctgg cgaaaactgg gaagtgattg aggacaatgg catgaagcac       240
     ggagtgactt ccatccacca gcatcctttc gacgaggata aagcttacgc gctgggagat       300
     gacgggaaac actggataac cacggataaa gcaaaaacat ggaagtcttt taaggttcca       360
     gaccaggcat atttcaaaag tccacaaacg ggccctctaa cgttccacgg acgggattcc       420
     agcaaagtca ttttcgaaac aagaccgtgc ccttcatgtg cgccacgatc atactataca       480
     acagacgact tcgatacaat agaagtgctg acagaaagcg cagtggggtg ctactgggca       540
     gttggaaatc ctcaattcgc agcaggtccc aatatgccaa aaggcatgga agagcgcact       600
     gtttgtgtag tcccaggtct caaggcgtcg tcaaggtttg cctttcgatt ggtctactct       660
     gacgactact tccgcagcca agggatcgag acgaaacttc aggatggccg accagtatct       720
     ggtgtgacca gtatcgcgca agtcaagagc ttcatcgtcg cggctgtcga atctcaagga       780
     accactgagc gtgctctata tgtaacaaca gatattgaaa agtggcatcg ggcggaattc       840
     ggagaccata ggctggaaca agacgcgtac actgtgctgg agagcagtga ttatagcctt       900
     caggttgacg ttctaacaaa tccgttcagc ggcatgggtg tacttttcac ttctaactcg       960
     gatggcacct attttactcg caacattgaa cacactaatc gcggcccaag gggctacgtt      1020
     gatttcgaga aattagctgc tatccaaggg atagtattgg taaatactgt cagaaatccg      1080
     gacgatgtcg aggccggtgc atccaaagag gttgtcagtc agataagctt cgatgacgga      1140
     aggacttttc agcctctaaa atcaactgat gggcagcgaa tccatctcca ttcagttaat      1200
     tcggacacaa accttggacg agttttttcc agtcccgccc ctggattggt aatgggagtg      1260
     ggtaataccg gtgattacct cggtaagcgc tcagatgggc atttgtatgt cagcgatgat      1320
     gcaggcctta cttggcgcct tgctcttaaa gggccgcaca agtatgaatt tggtgatcaa      1380
     ggggcagtgc tagtggcaat tagcgaagca cccaaagtta aaaagattga atactctctt      1440
     gaccatggaa aagagtggaa gtcagtcgat cttcctcatg aggtcgatgg tgaaacatct      1500
     actctaacca cgacccctga ttcaacgagc ttgaagttca tcctacttgg gcactcgaaa      1560
     ggagaaccct ctgtttatgc aattgacttt gaggatttgc atgaacgaaa atgcgaagat      1620
     gaagactttg ataaccattg gcctgctcga ttggatgaac atggagaacc agattgcctg      1680
     atgggccaga aacaattttt cagacgcagg aaggctaatg ctgactgctt cgttgcggag      1740
     gcattcaaca gttctatgtc gaaattcgag ccgtgcaaat gtactgttga ggacttcgag      1800
     tgccagtcta cacggactga ggatggcaaa gactgtgttc caccgaagtc ttttaccccc      1860
     ccagatggag actgtataaa cccagatgat acgaccatga ttccgtcggg ctggaggttg      1920
     attcccggcg acgtttgtgt tcgcgatgat ggggttaacc tcgacaaaga tgttgaaata      1980
     ccctgcaaag atgtcaacaa taggccgaag agcaaagaaa ttacctctac catgaagatg      2040
     ttcagctcgg gcttgtccgc ttacaggtac ctcgaacgtc aagtgtcgaa tcttggggaa      2100
     gatgagacgg tcctgatgct cagccgcaat caggaattat tcgtgtctca tgaccatggc      2160
     caaacctggc agcaagaact aaaaggggcc agcattatga aaatcgtccc tcacccttac      2220
     aacagtgata ccgcctatat ccttactgac agcgaggagg tgttttacac cataaaccga      2280
     ggcgcgacgt ttgggtcttt tagagcgaag acgcttccgg actacgaaaa tggtccaatt      2340
     ctgaggttcc atcctttaaa gagagactgg ttactctggg ttggtacaga atgcgactct      2400
     ggcagctgcc actccaacgc ctattttagt gatgatcgag gggactcttg gaagaccatt      2460
     ttgcgccatg ccaaaaaatg cgagttcgag tataaggaaa atcgtccaga cagcttgtac      2520
     ctcgtattct gcgagcaata tgaaaatgag gacgacaaga aacggctgca attgatgtct      2580
     acaactgacg agaggttctc cgactgggaa actgttgaag aaaatcttgt ggaatatgcc      2640
     accagggctg aatacatcat acttgcttcc cacacagata aagataacgc tttgaaggct      2700
     agggttagtg tcgacggtac aacatttgcc gatctgaagt ttccgcccaa tgtcgtgcca      2760
     gctcaaaatc tatacaccct tgttgacgcc tctgagcacg ccatcttcct gtatgtcgga      2820
     gggagtaata acaccggctc attgataaaa agtaacagca acggcacaac atatgtcctt      2880
     agtttggatg ccgtgaacca aaacgactgg ggatatgttg atttcgagag aatgcaggct      2940
     ttggagggtg tcataattgc gaatattgtc agcaatgttg acgagctttc cgacggagca      3000
     cccaagaggc tgaggacaat gatcactcac aatgatggtg gtgagtggac attattagca      3060
     ccgccaacca aggacgccaa tggcaagaag ttcccctgtt ctgttgttga ggggaaaggc      3120
     actgaagatt gtgcgcttca ccttcacgga tacaccgagc gcgcagatcc gcgagataca      3180
     ttttcctccg gttccgcgat tggcttgatg atgggcttgg gcaacgtggg ggatcggcta      3240
     accagcaaag atgaagcaga caccttcctg accatggacg gtgggatcac ctggaagtcc      3300
     gtcaagaaag gtagatatat gtgggaatat ggcgactcag ggtccgtaat tgtgatcgta      3360
     tctgaacaga agtcaacaaa agtcctgcat tacagcaccg acgagggcgc cacctggcag      3420
     gactattatt tttcggatga ggaaattgag gttattgata tctccactgt accctcagat      3480
     acctcaaaga aattcattct atggggcaaa aaatcggacg agcttgttac cgtcaatgtc      3540
     gacttcagcg ggctttatga tagggactgt gaattcgacg acaagggtgg agatgtcagt      3600
     gacgattatc agctctggac cccgaagcat ccattccagg aggaaaattg tttgttcggg      3660
     catgttgagc aatatcgtcg caagaaacct tcagctgaat gttggaataa ttggcgggga      3720
     ccgcatctgc acagtatcca aagaaattgc acttgcacta cagctgatta cgaatgtgac      3780
     tataactacg aacgtcaaaa tgacggcaca tgcaagcttg tgcctggttt gaaaccacat      3840
     gatccagttg gctattgcaa agcccatcca gatgcgatcg agtattttga gcctactgga      3900
     taccgtcgca ttcctcagac gacgtgtcaa ggtggctata acttggacca tcagaccgca      3960
     aagccttgcc ctgggaagca acaagagtac gataagaagc atggaattag tggcatcggg      4020
     cttttcttcg ccatcgtggc acctattgct gttgcaggag ctgtcggtta ttatatctat      4080
     accaaatggg atggcaaatt cggccaaatt cggctcggag aaacttcaac cgggacacaa      4140
     ggaattctat ctcgagattc cttgctggtt actgttccga tagccatcat agctggcatt      4200
     gttgctgtcg cgaaggcgct tccattgctg gttacgagtc tatggcggag tgctagcgga      4260
     tatatgcgtg ttggtaatcg cagctaccca cgcccatacg catctagggc ttcgttcgct      4320
     gctcgacgag gcgattatag tagcgtggtt gaagatgaag acgagctact tggtgtcgta      4380
     gattttgatg gcgacgaaga ggaggattca taa                                   4413
//

If you have problems or comments...

PBIL Back to PBIL home page