(data stored in ACNUC16935 zone)

EMBL: BN001307.PE208

BN001307.PE208       Location/Qualifiers
FT   CDS_pept        join(583152..583641,583689..584260)
FT                   /locus_tag="ANIA_08878"
FT                   /old_locus_tag="AN8878.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007994"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007994"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007994"
FT                   /db_xref="GOA:Q5AS52"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="InterPro:IPR038887"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS52"
FT                   /protein_id="CBF84753.1"
FT                   /translation="MVSRRDRELLRDNIRSRGAKLSATDRENIMKPYLPDPSELPRWPP
FT                   QRRRKLPRKTPIRTFIKSQIHLITYTFLHIFFGIAVRLVQTYHAVLDRILAIIYYHHRT
FT                   PELIRKDVKDLDRLPGHLSVILSLRKEDDALPILMDEVAELVSWSASAGIPVLSVYEKS
FT                   GLLKSCIPMLHQVITNKLSSYFGSLQQPTLQLFAPHHPIYKTRPAGDAAKNSLVVLLLS
FT                   ATDGQETLVDLTKTLAEMSQNGKLSPDDITMELVDAEISEITTQPSQDVAPTANDHKVS
FT                   KPLQVKPEPDLLLVFGPSLKLNGYPPWHIRLTEMYCTGVNSDGFTGYGDNVEYQGFLRG
FT                   LWHYAGAQMRFGR"
     atggtttcaa ggcgtgacag agagctacta agagataata tccgatctcg gggagccaag        60
     ctaagtgcta ccgatcggga aaatatcatg aagccatacc ttccagaccc atcagagcta       120
     ccgcggtggc cacctcagcg gcgcagaaag cttccccgaa aaactccaat ccgtacattc       180
     ataaaatcgc aaattcacct cataacctat accttccttc acattttctt tggtatcgcc       240
     gtgcgactcg ttcagaccta tcatgctgtt ctggatcgaa ttctggcgat catttactat       300
     caccaccgaa caccagaact gatacggaaa gatgtaaagg acctggatcg cttacccggg       360
     cacttgagcg tgattttgtc tctccgcaaa gaagatgacg ccctgccaat cttgatggac       420
     gaagttgcgg agcttgtatc ttggtctgct agtgctggca taccagtact gagtgtctac       480
     gagaagagtg gtctcctcaa atcgtgtatt cccatgttac accaagtcat caccaacaag       540
     ctgtcttctt actttggctc cttgcagcag cctacacttc aactcttcgc accacaccac       600
     ccaatataca aaactcgtcc ggctggtgac gccgccaaaa attctctggt cgtcctttta       660
     ttgtctgcga ccgacggcca ggaaaccctc gtcgatttga caaagactct ggcagagatg       720
     tcccagaatg gaaaactctc accggacgac atcaccatgg aattagtcga tgcggagatc       780
     agcgagatca ctacacagcc atcccaggat gttgcaccga ctgcgaacga ccacaaagtg       840
     tcaaaacccc ttcaagtcaa gccagagccg gatctccttc ttgtctttgg accttcactg       900
     aagcttaatg gttacccacc ctggcatata cgcctgactg aaatgtactg cacgggagtc       960
     aacagtgatg ggtttacagg ctacggtgat aatgtggagt atcaaggatt tctcagaggc      1020
     ctctggcact atgctggtgc acaaatgagg tttggacgat ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page