(data stored in ACNUC16935 zone)

EMBL: BN001307.PE209

BN001307.PE209       Location/Qualifiers
FT   CDS_pept        join(585690..585953,586014..587414)
FT                   /locus_tag="ANIA_08877"
FT                   /old_locus_tag="AN8877.4"
FT                   /product="ELMO/CED-12 family protein (AFU_orthologue;
FT                   AFUA_8G02810)"
FT                   /note="transcript_id=CADANIAT00007995"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007995"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007995"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS53"
FT                   /protein_id="CBF84754.1"
FT                   /translation="MDSNVSELVERLGSEEDAVRKMAVFKLQSSIGDPSFADVFIAEDG
FT                   LTRLRYLTLHATGNTLAYSLTSFARLLEVDKGWECVDHELVERVVELIVTHPLVNILRG
FT                   AMSILVSIVSHPSSVGRLSQNAVWGFRALKPAIAIYPQFLEMLVNRLSSADHALCANAL
FT                   QLINSLMRDSITNDSDHEWPKFIQKLQDLGVIKAVYSLMQGTALQDHAHPLIEFQSLTK
FT                   ILLRKWRDTALDLENPEHRRALKGIHLASSQEKGNETGADMRRSKKHSPEKWRRLGFES
FT                   ESPVAQFEDMGFLGMMDLADYVRNHQDEFQKMLLEQSTKPARQRCPIARASLSVTSILY
FT                   DHFEVDKCETEDSKTYLILESRSNLDKLFKPLLLHWTRLHVAGLHSFFRLWKSTSAELE
FT                   DYDKIVELVRILIESVVGGAARTKDVQDVEEDLMEFEYSRLRDLQMELLELTYEDAWGQ
FT                   HLRQVREELQHEAAQFVKEQRIRCLLQGAWFPNENISELEGESGSPKWRYVQLSHNRRI
FT                   LHFGDFESMEMNRLDLDVLPGKSEVPLQPAIFELLAN"
     atggatagca atgtttcaga gctagtcgag agactaggga gtgaagagga tgcagtgcgc        60
     aagatggctg tattcaaact ccagagcagc attggagacc cttcgtttgc agacgtattc       120
     atcgcagaag atgggctgac aaggctccgt tacttgactc tgcatgcgac tgggaatact       180
     ttggcatata gcttaacgag ttttgccaga ctgttagagg ttgataaggg atgggaatgc       240
     gttgatcacg agttggttga aagggttgtt gaactcatcg taacgcaccc cttagtgaac       300
     attttgcgag gcgcaatgtc tatactcgtc tccatcgttt cgcatccttc ctctgtcggt       360
     cgcttgtcgc aaaatgctgt atggggattc cgcgcgctga agcctgcaat tgcgatctat       420
     ccccagttcc tagaaatgct tgtcaacagg ctttcttcag ccgatcacgc gctttgtgca       480
     aatgctttgc aattgatcaa ctcattgatg cgcgattcca taacgaatga ctcggatcat       540
     gaatggccga aattcatcca aaaactgcag gatctcggag ttatcaaggc cgtctattcc       600
     ttgatgcaag gcacggcgtt acaggaccac gcgcaccctt taatcgaatt ccaatcactt       660
     acgaagatcc tcctgcgcaa atggcgagat actgctttgg acctcgaaaa tccagagcat       720
     aggagagctc ttaagggcat tcatcttgct agtagtcaag agaaggggaa tgaaaccggc       780
     gccgatatgc gacggtcgaa gaaacacagc cccgaaaaat ggcggcggct cggattcgaa       840
     tcagagagtc cagtcgcaca atttgaagat atggggtttt tgggcatgat ggacctggcg       900
     gactacgtcc gaaatcacca agacgaattt caaaagatgc ttcttgaaca gtcgacaaag       960
     ccagcccggc agcgatgtcc gattgcgcgc gcttcgctat ccgttacatc tatattatac      1020
     gatcattttg aggttgacaa atgcgagact gaagatagca aaacctactt gatacttgag      1080
     tctcgttcta acttggataa actattcaaa cccctactgt tacactggac ccggctacat      1140
     gtggccggat tacatagctt ttttcgtttg tggaagtcga cgagtgcaga actggaagac      1200
     tacgacaaaa tcgtggagct ggttcgtata ctcatcgagt cagttgttgg aggtgcggcc      1260
     cgaacgaaag acgtacagga tgtggaggaa gacttgatgg agtttgaata cagccgactt      1320
     cgagacctac aaatggaatt actggaactt acttacgagg acgcttgggg gcaacatcta      1380
     cgacaggtgc gcgaagagtt acagcacgag gccgcccaat tcgtcaagga gcaaagaatc      1440
     cggtgcctgt tacaaggtgc ttggttccca aacgagaata tatctgagtt ggaaggggaa      1500
     tcgggtagtc ccaagtggag atatgttcaa ctttctcaca atcggaggat cctccatttt      1560
     ggagatttcg agagcatgga aatgaaccgt ctggatctcg acgtgcttcc cggaaaaagt      1620
     gaggtaccct tacaacccgc tatattcgag cttctggcta actag                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page