(data stored in ACNUC16935 zone)

EMBL: BN001307.PE21

BN001307.PE21        Location/Qualifiers
FT   CDS_pept        complement(58876..59415)
FT                   /locus_tag="ANIA_09040"
FT                   /old_locus_tag="AN9040.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007812"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007812"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007812"
FT                   /db_xref="GOA:Q5ARP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP0"
FT                   /protein_id="CBF84408.1"
FT                   /translation="MWLTRGFSRITETLSSLFCRSHSQSHSCSQTRERTRSAFNEGELE
FT                   GESGWQTCRPRHLTERRLSGFQPPPTEEEYTSSFFHGWYLPYNVRGLSQVEPEPEPEPA
FT                   PEADVELEDLPRYEHPPAYTNRSPPAEAHEIGSNSRNESLDVTECRPAPGLSNEPDTMA
FT                   VTGQPDNAPNDRRGPT"
     atgtggctga ccagaggctt ttctcgcatc actgaaacct tgtcctctct cttctgtcgc        60
     tctcactctc aatcccattc ttgctctcaa actagagaaa gaactagaag cgcattcaac       120
     gaaggtgagc ttgaaggcga gtccgggtgg cagacttgcc gcccccggca tttgactgag       180
     cgtcgcctct ctggctttca gccccctccg accgaggagg aatataccag ctctttcttt       240
     cacggatggt acttgcccta caatgtcaga ggtctaagtc aggtagagcc cgagcccgag       300
     cccgagcccg cgcctgaggc tgacgttgaa ctcgaagacc tacctcgtta cgagcaccct       360
     ccggcatata ccaacagaag tccgccagcc gaagcccatg aaatagggag caacagccgt       420
     aatgagtctc tggatgttac ggagtgccgt ccggctcctg gactgagcaa cgagcctgat       480
     accatggccg tgaccggaca acccgacaat gctcctaatg acaggcgggg cccgacgtga       540
//

If you have problems or comments...

PBIL Back to PBIL home page