(data stored in ACNUC16935 zone)

EMBL: BN001307.PE210

BN001307.PE210       Location/Qualifiers
FT   CDS_pept        join(588327..588827,588903..590702)
FT                   /locus_tag="ANIA_08876"
FT                   /old_locus_tag="AN8876.4"
FT                   /product="cell cycle checkpoint protein Rad17, putative
FT                   (AFU_orthologue; AFUA_8G02820)"
FT                   /note="transcript_id=CADANIAT00007996"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007996"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007996"
FT                   /db_xref="GOA:C8VLU6"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLU6"
FT                   /protein_id="CBF84756.1"
FT                   /translation="MRNHKTQQLSDTTVCGLLQSASEPNYSHRRWPNSQMPGSAGTADV
FT                   DDNEDSIEDDYDSYDDLFTQHFTDEKLSHLDGIKVAPRPQNRAISPIGNAKDQTAKNAK
FT                   HFFWKSVSPSNNELPNPTPSEKGALPWAQRYAPLNLDELAVHKRKVGDVERWLSDALEG
FT                   KTRKNLLILRGPAGSGKTTTISLLSKKLRFDVLEWKTPSTVTYSSKDYVSFGAQFDGFL
FT                   SRSHIFGSLTLDGHHSSQVPLNNDHASQRRVILIEEFPTMAARNTTVLASFRLSILRYL
FT                   SLNGPHGGNTYGREVRVPPIVMVVSETFSSTESSFNNLTTHQLLGRELYNHPDTTIIEF
FT                   NSIAPTFMHKALNLVLKKSSCQPCGNQTLTQSIIENISKIGDIRNAIASLEFICLGNGN
FT                   KGYWSDPTVKTRRTARTRMKNTAVGSEMREEIAQREASLGLFHAVGKIIYNKRSDASDA
FT                   EHVQLPSPPDHLRDHDRPTVSMVHVNELLDETGTDIQLFIGTLHENYVPSCNGSSFTEC
FT                   LEGCIGFLSDSDMLCYDRKDRSKFQAGLGIGTVKIETGGVDVLRQEEISYQVAARGLLF
FT                   SLPYPVRRQLSYARNIKQAGDSHKVFFPPVIRLVRQLQEISNQIDSWKDALLSSTVRPT
FT                   AVPMKDHTTREFISGKGKSLQGNRDEESPSLVAMLSRSDLILHQLPYLTKIVGKGTMSK
FT                   NLQQSTGFGAGGSDFTSQHDEDYDFEPSFCEAPGPKSRLEKRIGLSEPQTTLSSQTTDE
FT                   RLVLSDDDIIDDL"
     atgagaaacc ataagacaca acaactgagc gatacaacag tgtgcggatt acttcagagc        60
     gcgagcgagc cgaattattc gcaccggcga tggccaaact ctcagatgcc aggtagcgca       120
     gggacggcag atgtggatga taacgaagac tcgatcgaag atgattatga ctcatatgac       180
     gacttattta cccaacattt caccgacgaa aaactctctc acctcgacgg gataaaagtc       240
     gcgccccggc cgcaaaacag agccatctct ccaataggca atgcaaaaga ccagactgcg       300
     aaaaacgcca aacatttctt ctggaaatca gtatctcctt caaataatga gttaccgaac       360
     cccaccccgt cggaaaaagg ggccttgcct tgggcacaac gatatgctcc cctcaacttg       420
     gatgaactgg cagttcacaa acgtaaggtt ggcgatgtcg aacgatggct gagcgatgcg       480
     ctcgaaggga aaactcgaaa gaatttactc attctcagag gaccggcggg aagtgggaaa       540
     accaccacca tctcactact atccaagaag ttaagatttg atgtcctgga gtggaaaact       600
     ccttcaaccg tcacgtactc ctccaaagat tatgtttcat tcggggccca atttgatgga       660
     tttctgagcc gtagtcatat atttggcagc ctaaccttgg acggtcacca tagctcacag       720
     gtccctctga acaacgacca cgctagtcag cggcgtgtca tcctcattga agaatttcca       780
     acgatggctg cacggaatac tacagttttg gcttctttcc ggctgtcaat tctacgatat       840
     ctctccttga atgggccaca tggtggaaac acgtacggta gagaagtaag ggtaccgcct       900
     atcgtcatgg ttgtgtctga aactttttca agcacggagt cctcattcaa taatctgaca       960
     acccatcaat tacttggtcg cgagctctac aaccatccag ataccactat catcgagttc      1020
     aacagcattg cgccgacatt catgcacaaa gctctaaacc tcgtcttgaa aaaaagctcc      1080
     tgtcagccct gcggcaatca aacgctgact cagtccatta ttgagaacat ttctaagatt      1140
     ggagatatcc ggaatgcgat cgcgtcattg gaattcattt gtctaggtaa tggcaataaa      1200
     ggctactgga gcgatcccac tgtcaaaact aggcgtacag ctcgaactcg catgaagaat      1260
     accgctgttg gaagtgagat gcgggaggaa atagcgcaaa gagaagcaag tctaggacta      1320
     ttccatgcag tcggcaaaat catttacaac aagcgaagtg atgcatctga tgccgaacac      1380
     gtgcagttgc cctctcctcc agatcacctc cgtgaccatg accggccgac agtctctatg      1440
     gtacatgtta atgaactgtt agatgagacg ggcaccgaca tccaattgtt cattggcacg      1500
     ttacatgaga attatgttcc atcttgcaat ggttcttcgt tcaccgaatg cttggaaggt      1560
     tgcataggat tcttatcgga cagcgatatg ctttgctatg accgaaagga tcgtagcaag      1620
     ttccaagctg gtcttgggat tggtaccgta aaaatcgaaa ctggtggcgt tgatgtactg      1680
     cggcaagaag agataagcta ccaagtagct gcgcgcggcc tactcttctc tcttccttat      1740
     cccgtgagaa ggcagttgtc atacgccaga aacataaaac aggcgggtga ctctcacaag      1800
     gttttctttc ctcccgtcat ccggcttgtt cgtcagctcc aggaaatcag taatcaaata      1860
     gattcgtgga aagacgcctt gctcagctca accgttcggc caactgctgt cccgatgaaa      1920
     gatcatacaa ctcgcgagtt tatctctgga aaaggtaaaa gtctccaagg taatcgcgat      1980
     gaggaatcgc catcacttgt tgcaatgctc tcgcgcagcg acttgatcct tcatcagtta      2040
     ccctatctga caaagattgt tggcaaaggc acgatgtcaa aaaacctaca gcaaagcacc      2100
     gggttcggag ctgggggctc agacttcacc tcacaacatg acgaggatta cgatttcgag      2160
     ccatcctttt gtgaagcccc aggccccaag tctagacttg aaaagaggat tggactgtct      2220
     gaaccgcaga caaccttgtc ctcccaaaca accgatgaac ggcttgttct cagcgatgac      2280
     gatattatag atgacttgta a                                                2301
//

If you have problems or comments...

PBIL Back to PBIL home page