(data stored in ACNUC16935 zone)

EMBL: BN001307.PE213

BN001307.PE213       Location/Qualifiers
FT   CDS_pept        complement(join(597787..597873,597970..598239))
FT                   /locus_tag="ANIA_11147"
FT                   /old_locus_tag="AN11147.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007999"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007999"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007999"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR035718"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLU9"
FT                   /protein_id="CBF84762.1"
FT                   /translation="MVDKDWWLGSNAQGERGLFPSNYVELLEDGRQSRAESDTRPADAH
FT                   ESEALADPTPTSGSHVKPTAKALYDYEAAEDNELSFPEGAEIINIEFPDDDWWLGEFRG
FT                   KTGLFPANYVQLDD"
     atggtcgaca aagattggtg gttgggatcg aacgcccaag gggaaagagg actttttcct        60
     agtaactatg ttgagctcct tgaagatggt cgtcagagcc gcgccgagtc cgatacccgg       120
     cctgctgatg cccatgaatc tgaggcacta gccgatccta ctccaacctc aggctctcac       180
     gttaagccca ctgccaaggc tctttatgat tatgaggcgg ccgaggataa tgaactcagc       240
     tttcctgagg gggctgaaat cataaacatt gaattccccg atgatgactg gtggctaggt       300
     gaattccgtg gcaaaacagg gctttttccg gcgaactatg tccagcttga tgattag          357
//

If you have problems or comments...

PBIL Back to PBIL home page