(data stored in ACNUC16935 zone)

EMBL: BN001307.PE214

BN001307.PE214       Location/Qualifiers
FT   CDS_pept        complement(join(598550..598593,598716..599814,
FT                   599877..600064,600186..600399,600651..600758))
FT                   /locus_tag="ANIA_11139"
FT                   /old_locus_tag="AN11139.4"
FT                   /product="actin binding protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008000"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008000"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008000"
FT                   /db_xref="GOA:C8VLV0"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV0"
FT                   /protein_id="CBF84764.1"
FT                   /translation="MTNAFGKALRHWVSPRSGQLNRATVWTSVTYFQTDSFEQIQTLET
FT                   CSTSVFFTEEDLDCQHGISQPIGQWTFDIEELSVSGRLCNNGFCKEFFNIRQMGIVLCF
FT                   NAPEGELADLIDEFSEGKIQFAFVKVIDTNTGLPKSVLIAWCGEGVPERTKGYFTSHLS
FT                   TVSKFLHGYHVQITARSEADLTVEGIIQKVGDASGAKYTQGLEKPNASVPKPPVSSKPV
FT                   FTPLRTGGINVNAAAAAPLPLRAKKNDDDGWGPDAPPVTRTNLEKVEPAYKPTRVNIQE
FT                   LKSEKQNEPTVNPSLTTGHQPDGVIKGGYQPIGKVDIAAIRRQAREAGNLTDDRPEPVK
FT                   GAYQPVGKVDIAAIRARAQKPDETDTSSKGSSARPDGSSGPTTDLDSTESSRLTSLPKP
FT                   KVTNKFASSTSFTGTKPPLPGGNALSATPVPPIGSASRTFADQGGKTPAQLWAEKKAKE
FT                   RSQEPAAAEESTKPAVANNVQSQLSGVREWKSSYTGRTWAPVQTTHTGKSVENNRTEVA
FT                   GSFATGMPTPEAITAQQSEATSSAATCPADPNT"
     atgactaatg cctttggaaa agcgttgcgg cactgggttt ccccgaggtc cggtcaactg        60
     aacagagcta ctgtctggac tagtgtgacg tacttccaaa ctgattcatt cgagcagatt       120
     cagacacttg aaacgtgctc cacgagtgtg tttttcactg aagaggattt agattgtcag       180
     catggcatct ctcaacctat cggccaatgg accttcgata tcgaagagtt atcagtcagt       240
     ggtcgattat gcaataacgg attctgcaaa gagttcttca acattcgcca aatgggtatt       300
     gttctctgtt tcaacgcccc tgagggagag ttggctgatc tcatcgatga attctccgag       360
     ggaaaaattc aattcgcttt tgtcaaggtc atcgatacta acacaggcct gccgaaaagt       420
     gtcctcattg catggtgtgg ggaaggtgtg cccgagcgga caaaaggata ctttactagc       480
     cacttgtcca cggtgtcaaa attcttacat ggataccacg ttcagataac agctcgctca       540
     gaagccgact tgacagtgga aggtattatt caaaaagttg gcgatgcatc aggtgcgaaa       600
     tatacacaag gactcgaaaa accgaacgcg tctgtcccaa aaccaccagt atccagcaag       660
     ccggtcttta ctcctctccg aactggaggt atcaatgtga acgcagccgc cgccgctcca       720
     ctgccactaa gagcgaagaa aaacgacgac gacggatggg gccccgatgc tcctcccgtt       780
     actcgaacca atctagagaa agtcgagccg gcttataaac cgacccgggt caacatacag       840
     gaactcaaat ctgagaagca gaacgagcca accgtgaatc ccagtctcac aacaggccac       900
     caacccgatg gtgtcatcaa gggcggatat cagcctatcg gtaaagtgga tattgctgct       960
     atcagaaggc aggcgcgcga ggctggcaac ctaacggatg accgaccaga gcccgtcaaa      1020
     ggcgcatacc aaccagtcgg caaggtcgat attgctgcga ttcgtgcaag ggctcaaaaa      1080
     cctgatgaga ctgacacaag ttcgaaggga agttccgccc gacccgatgg gtcttctggc      1140
     ccgactacag acctggattc cactgaatca agccgcctaa catccctgcc taagcctaag      1200
     gtcaccaata agttcgctag tagcacatcg tttaccggca caaagccgcc ccttcccggc      1260
     ggcaatgcgt taagtgccac gcctgtgcct cctataggga gcgctagtag aacctttgcc      1320
     gaccaaggtg gtaagacacc tgcgcagctc tgggcagaaa aaaaggcgaa agagcgcagc      1380
     caggaacctg ctgctgctga agaatcaacc aagcctgctg ttgccaacaa cgttcaaagc      1440
     caacttagtg gtgtcaggga gtggaagagc tcttacactg ggagaacctg ggcccccgtc      1500
     cagactacgc acacgggaaa gtctgttgaa aataaccgca ctgaggttgc aggctctttt      1560
     gctaccggga tgcctactcc agaggctatt acggcacagc aaagcgaggc cacaagctcc      1620
     gcagccacct gtcctgcaga cccaaatacc tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page