(data stored in ACNUC16935 zone)

EMBL: BN001307.PE216

BN001307.PE216       Location/Qualifiers
FT   CDS_pept        complement(604191..606008)
FT                   /locus_tag="ANIA_08871"
FT                   /old_locus_tag="AN8871.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008002"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008002"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008002"
FT                   /db_xref="GOA:C8VLV2"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV2"
FT                   /protein_id="CBF84767.1"
FT                   /translation="MSQAASTTSRKPRRFLPEPIETSSRSSKNRQDNELTTQCLHQMQT
FT                   SFRTSEIRSTSCKNEDSGRSSHPPPQQTCLSPCLTTDHDAHRFTATMHKTPFTQVIGGN
FT                   QQGNAKRYTPQLMETVRHSFRPGKKPAKLFSSAGLGTQSSRDAIEAANRMEADHGAVQE
FT                   SRFSYSSLLRRQETRRHSFRVPDLPAIPSSGSDESNESDSPQVSSETIATARGTFSDDT
FT                   ARPRNGREMSFIEYILPFPRHPSENQLKEQALAAFPNEQVYQQVDHFAIDRDEEEPVNE
FT                   DIIKIRDPELEFRTRRRASSADLPSELEYLRKHKEEAGMNRRHYFTTRGACFSTCAVYQ
FT                   TSRKSGKPANHDDGWDPNSPFARLRQAASPPMLGGDLIFPQSLTPKTTICEHPNSVGSQ
FT                   GHRDHSLGSGLWSACPCSSAQYDIGGLWNGTCKSDRYSTHGVENLSREAITPKKDVINN
FT                   NSGNLDASSKASNLRHRKRQNAVQSPTNESADSERIDQEFNDDFVTQIYDYLSLGYPSI
FT                   ARYFDHELSRVSGLPIAALRADDLNMDAKGYVGVNDITNKGVANRVCMRWTALKLYIHE
FT                   WARQHPRMLEAGHYHETWGVSERKGSWAV"
     atgtctcagg ccgcctccac aacatctaga aagccacgga ggttcttacc tgagcccata        60
     gagacatctt cacgcagttc caagaatcgt caagacaatg aattgacaac ccaatgttta       120
     catcaaatgc aaacaagctt ccgcacatct gaaataaggt ccacctcgtg caaaaatgag       180
     gactctggca ggagttcaca ccccccccca caacagacgt gcttgtcacc ttgtttaaca       240
     acagaccatg atgcgcacag attcacagca acaatgcaca aaaccccatt tacgcaggtg       300
     attggaggca accagcaggg aaacgcgaag agatacactc cccagctaat ggagactgtc       360
     agacactctt ttcgcccagg gaagaagcca gccaaactgt tcagctcagc ggggcttggg       420
     acacaaagct cacgggacgc catcgaggcc gccaatcgaa tggaagcgga ccatggcgct       480
     gtacaagaat cccggttctc atactccagc ctcctacgac gccaagaaac gagaaggcac       540
     tcatttcgtg tgcctgatct gcctgcaatt ccctctagtg gcagcgatga atcaaatgag       600
     tcagactcac cccaagtgtc cagtgaaact attgccacag cacgagggac attctcagat       660
     gacactgcac gtccaagaaa tggccgagaa atgtccttca ttgaatacat tctcccgttc       720
     ccacgccatc cctcggagaa tcagttgaag gaacaagccc tggcagcctt tccaaacgag       780
     caggtttacc agcaagtaga tcacttcgca atcgaccgag acgaagaaga gcccgttaac       840
     gaagatatca tcaaaatacg tgatccagaa ctcgagttca ggacaaggag gcgcgcttca       900
     tccgcagatc tcccttcgga actcgaatac ctacgcaagc ataaagagga ggctggtatg       960
     aataggcgcc attattttac aacgagagga gcatgctttt caacgtgtgc tgtctatcaa      1020
     acttccagga aatcgggcaa acctgcaaac catgatgatg gatgggaccc aaactctccc      1080
     tttgcacgat taaggcaggc ggctagcccg ccgatgctcg ggggtgatct catatttcca      1140
     caaagcctga ctcctaaaac cacaatatgt gaacacccga acagtgttgg ttctcaaggt      1200
     caccgcgacc actcattagg ctcaggcctc tggagtgcct gtccgtgttc ttctgctcaa      1260
     tatgacattg gcgggctttg gaatgggact tgcaagtcag accggtattc tacacatggt      1320
     gttgaaaatt tatcgaggga agctattacg cccaagaaag atgtcataaa caataattct      1380
     ggaaatttgg atgcatcatc taaagccagt aacctccgtc accgaaagcg gcagaacgcc      1440
     gtccaaagtc cgacaaatga atccgccgat agcgagcgca tcgatcagga gttcaatgac      1500
     gatttcgtta cacagatata cgattattta tcgttaggat atcccagcat tgcccgttac      1560
     ttcgaccacg aattaagtag ggtttcgggg ttaccaatag cagctctcag agcggatgac      1620
     ttgaacatgg acgccaaagg ttatgttggt gtgaacgaca ttaccaacaa gggagtggcg      1680
     aatcgtgttt gtatgaggtg gacagctttg aagttatata ttcatgaatg ggcacgccaa      1740
     catccccgca tgctcgaagc agggcattat catgagactt ggggggtaag cgaacgcaag      1800
     ggaagctggg ctgtctga                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page