(data stored in ACNUC16935 zone)

EMBL: BN001307.PE218

BN001307.PE218       Location/Qualifiers
FT   CDS_pept        complement(join(616737..617101,617301..617403))
FT                   /locus_tag="ANIA_09418"
FT                   /old_locus_tag="AN9418.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008004"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008004"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008004"
FT                   /db_xref="GOA:Q5AQL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQL2"
FT                   /protein_id="CBF84771.1"
FT                   /translation="MAQRSDVAVHGRKRPAEEELDDQPLTKKFGRLQIEQELAETEILD
FT                   GAFTILPGIEDRLSLTNILVANDSKRPCTDVVLYREPESLSIPKDKDQVRRALIETRER
FT                   ARLSQQKLRSSPGQEKNDAACTDQNLTHKEECQQRANSDDDDAMDIDVDGY"
     atggcgcaac ggtctgatgt tgcggttcac ggaagaaaac gccccgccga ggaggaactt        60
     gatgatcaac ctctaacaaa aaagtttggt cgcctacaga tagagcagga actggccgaa       120
     accgaaattc ttgatggtgc cttcacaatc ctaccaggaa tagaggatag gctgtccttg       180
     acaaacatac tggtggcaaa tgatagcaag cgcccgtgca ctgatgtggt gctctacaga       240
     gaaccggaat cgctttctat tcccaaggat aaggatcagg tgcgacgagc tttgatagaa       300
     acaagagaaa gggccaggtt gagtcagcag aagcttcgga gcagcccagg acaagagaaa       360
     aatgacgcgg cgtgtactga ccaaaacttg acgcacaaag aggaatgtca gcagagggcc       420
     aactcagatg acgacgatgc aatggatatt gatgtagatg gttactag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page