(data stored in ACNUC16935 zone)

EMBL: BN001307.PE22

BN001307.PE22        Location/Qualifiers
FT   CDS_pept        complement(join(60985..62287,62339..62376))
FT                   /locus_tag="ANIA_11161"
FT                   /old_locus_tag="AN11161.4"
FT                   /product="phosphatidylserine decarboxylase family protein
FT                   (AFU_orthologue; AFUA_7G01730)"
FT                   /note="transcript_id=CADANIAT00007813"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007813"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007813"
FT                   /db_xref="GOA:C8VKQ9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKQ9"
FT                   /protein_id="CBF84410.1"
FT                   /translation="MPSHSSNTHRYHRVGHWMPSGYDDHHKWLGGVIAHVDSKQDKELH
FT                   PVLKEFQHLIETNTRVYMLISAMFAEVPKNRHYCKDPTGCSQIRDYHHMLQVLNHLITT
FT                   APSWNDFSLEVGLVGLPINAVLDWSMGTPSGYAAYLDPDINAMLKKVLNAWGEYLTSED
FT                   SAKVLGDDEYGWFGETGKNNLMHVANLPLGTDHEFDKLFVCDPSAKYHGYKSWDDFFTR
FT                   TFRPGVRSVASPDDDTVIVNACESQPYKVARGVKARDTFWIKGQPYSVADMLSHDPVTP
FT                   QFEGGTVYQAFLSALSYHRWHAPVSGKIVRAYVVDGTYYSEPLFEGLWDEEENKPKEQG
FT                   IDPGGEVTTQEYLTCVATRAIILIECDNPAIGLMAFLGVGMCEVSTCDITVKEGEHVRK
FT                   GDQLGMFHFGGSTHCLLFRKGVDVEGLPSPDLGRNVAVNSQLGVVKA"
     atgccttctc atagctctaa cacacaccgc tatcaccgag tgggccattg gatgccctcg        60
     ggctatgacg atcaccacaa gtggctcggc ggcgttattg cccacgttga cagtaaacag       120
     gacaaggaat tgcatccagt tctgaaggag tttcaacatc taattgaaac aaacacccgc       180
     gtctacatgc tgatctccgc catgttcgcc gaggtcccaa agaaccgcca ctactgcaag       240
     gatccgacag gctgctcaca gatccgagac tatcatcaca tgctgcaagt cttgaatcac       300
     cttatcacga cggcgccttc gtggaatgat ttttctctcg aagtcggcct tgtcgggctg       360
     ccgatcaatg cggtcctcga ctggtcgatg ggcacgccga gcgggtacgc ggcttatctt       420
     gatcccgaca tcaacgccat gttgaagaag gtcttgaacg cctggggcga gtacctgacc       480
     tcagaggact cggccaaggt tcttggggat gacgaatacg ggtggtttgg cgagacgggc       540
     aagaacaacc tcatgcacgt cgccaacctc cctcttggaa cagaccacga attcgacaag       600
     ctgtttgttt gcgacccgtc cgccaaatac catgggtaca agtcctggga cgacttcttt       660
     actcgtacgt tccggccggg agttcggtct gtggcctcgc ctgacgacga cacggtcatc       720
     gttaacgcct gcgagtccca gccgtacaag gttgcccgag gagtcaaggc aagggatacg       780
     ttctggatca aaggccagcc atattcggtc gctgatatgc tctcgcacga ccctgtcact       840
     ccgcagtttg aagggggcac tgtttatcaa gcgtttttga gcgcactcag ctatcatcgg       900
     tggcatgcac ccgtcagcgg caagatcgtc agagcgtatg tggtcgatgg gacctactac       960
     tctgagccgc tattcgaggg gctatgggat gaagaagaga acaagccaaa ggagcaggga      1020
     atcgacccag gcggcgaagt tacgacgcag gagtatctca cttgcgtcgc gacacgggcc      1080
     attatcctga tcgaatgcga taacccggcc atcgggctta tggcgttcct tggggttgga      1140
     atgtgcgaag tctcgacgtg cgatatcaca gtcaaggaag gcgagcacgt tagaaagggc      1200
     gatcagctgg ggatgttcca cttcgggggg tcgacgcact gtcttctttt caggaagggc      1260
     gttgatgttg agggtctgcc gtcgccggat ctggggagga atgttgctgt caatagccag      1320
     ctaggagttg tgaaggccta g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page