(data stored in ACNUC16935 zone)

EMBL: BN001307.PE221

BN001307.PE221       Location/Qualifiers
FT   CDS_pept        join(622409..622542,622599..623700)
FT                   /locus_tag="ANIA_09421"
FT                   /old_locus_tag="AN9421.4"
FT                   /product="RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G03900)"
FT                   /note="transcript_id=CADANIAT00008007"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008007"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008007"
FT                   /db_xref="GOA:Q5AQK9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK9"
FT                   /protein_id="CBF84777.1"
FT                   /translation="MSSTTSSSPAPTDNGSGDNGGSSPTSSPLLFFVALGFGVVFTNLW
FT                   IIVGVKYCFRYNQRNRQIRGGDNGEPIDLVAMPRTHRRRREKKLMTMDEVNERFPLTKY
FT                   KVWRSSRANAGLSTAGGITAAHTENALDAEDDQQSLPEGATSLVTAPDAKSHQRLNSAT
FT                   SQQPTKPVDDGDMAPESEEKSIKGFSRTNNASPRVSSDRINPVVRDHDYHTVEDIIPTT
FT                   VLTDLDTSPGDSCAICLDLIEDDDDIRGLSCGHAFHASCVDPWLTSRRASCPLCKADYY
FT                   TPKPRPDASDLPSTSGRRAASPNHPQAVLIRGRVNPFRAQTLYGQASQSAPDTVSGTSR
FT                   PIGHRLWAVRTTPTIEEGRSRNDTSIPRLSSWLSNFSNRFRVRNQDSTTVPGNSHLNAP
FT                   RTPSQLEAGQTR"
     atgtcttcaa caacaagctc ctcgccagcg cctactgaca acggctcagg tgataacgga        60
     ggctcaagtc ccactagctc tccacttctt ttttttgttg ctcttggttt cggggttgtc       120
     tttacaaatt tgtggattat agttggcgtg aagtattgct tccggtataa ccagcgcaat       180
     cgccaaatcc gtggcggaga caatggagag ccaatagact tggtcgcgat gccgcgtact       240
     catcggagaa gaagggaaaa gaaattgatg actatggacg aagtaaacga acggttcccg       300
     cttaccaagt ataaagtgtg gagatcatca cgggcaaatg ctggtctctc aactgctggt       360
     ggtataacgg ctgcccatac tgagaacgct cttgacgccg aggatgacca acagtccctt       420
     ccggaggggg ctacatccct cgtgactgca cctgatgcta aatctcatca gagacttaat       480
     tcagcaacgt cgcagcagcc aacaaaacct gtcgatgatg gtgacatggc gccagaatct       540
     gaagagaaga gtataaaggg tttctcccgg acgaataatg catcacccag agttagctcg       600
     gaccgaatta atccagtagt cagagaccat gattatcata ccgtcgagga tatcataccc       660
     accaccgttc ttacggatct tgatacaagc cctggagatt cgtgcgctat ttgtctcgat       720
     cttattgaag acgatgatga tatacgtggt ctttcttgtg gccacgcctt tcacgcctca       780
     tgtgttgacc catggctgac aagtcgaaga gcctcctgcc cgctgtgcaa ggcagattat       840
     tatacaccca agcctcgtcc tgacgcttcc gacttaccat ctacttctgg tcgtcgcgcc       900
     gcaagcccaa atcatcccca agctgttttg atcaggggcc gggttaaccc atttcgagca       960
     cagacactat atggacaggc ctcacagagt gctccagaca ccgtttccgg aacttctcgc      1020
     ccaataggcc acagattatg ggccgtacgg accactccaa cgatcgaaga gggtcgatcg      1080
     agaaatgata cctccatccc gcgactgtcg tcttggttgt ctaacttcag caaccgattt      1140
     agagtcagaa atcaagattc tacgacggtt cctggcaatt cacatctaaa tgctccgcga      1200
     acaccaagcc agctggaggc tgggcaaaca cgctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page