(data stored in ACNUC16935 zone)

EMBL: BN001307.PE222

BN001307.PE222       Location/Qualifiers
FT   CDS_pept        complement(join(624283..624849,624916..625047,
FT                   625116..625276,625335..625659))
FT                   /locus_tag="ANIA_09422"
FT                   /old_locus_tag="AN9422.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008008"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008008"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008008"
FT                   /db_xref="GOA:Q5AQK8"
FT                   /db_xref="InterPro:IPR024382"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK8"
FT                   /protein_id="CBF84779.1"
FT                   /translation="MRSVFSFLTTIGAISVGATALEASVITFGSVTQKQGLKSPDISSA
FT                   TLLQLLELRTKSPTTSSLQSSDEENLEFLNRLAGPPTRLFGAPAADGGLDTLLVVLEGL
FT                   TDEIGRSIQAEYQDELLITEFVTGSAEDTFLDYILEARLEGIVSPESKRCSLTSDSNEG
FT                   FVMSCLPANFNLTLGSGFLGQITSGESWIDNRKELVVMHIAFKGSTAYINDLKAFLSGL
FT                   RSLSLNGRRVTAVALPDLNASQKLSRTRRAPEHTALDTTFSWDRDERLMIADQHAQASL
FT                   SLGPVCYASNSSCNDATDTCSGHGACYEKSGGCYACLCHDTYVKTASGTERKIRWGGSA
FT                   CQKRDISSPFFLIMGVTVAVLLAVISAIAMIFGIGNDELPGVISAGVGTVRAQK"
     atgcggtcgg tcttcagctt cttgaccacg ataggcgcca tctctgtggg agctaccgct        60
     ttggaagctt ctgttatcac ttttgggtca gtaactcaaa agcagggcct gaaatctcca       120
     gatatatcaa gcgccactct cctacagcta ttggagcttc ggaccaaatc acccaccacg       180
     tcatctttgc agagctcgga tgaggaaaat cttgagttct tgaacagatt ggcaggtccg       240
     cctacacgtt tgtttggtgc gcccgctgcg gatggaggat tagatacact cctagtcgtg       300
     ctagaaggtc tgactgacga aattgggagg tcaattcagg ctgaatatca agatgaactg       360
     ctaatcactg aattcgtcac gggttctgcg gaagatactt ttctcgatta cattctggag       420
     gccaggcttg aaggcatagt cagcccggaa agcaagcgct gctcactcac ctctgatagc       480
     aatgagggtt ttgtcatgtc atgtcttcct gccaacttca atttaaccct tggtagtggg       540
     tttctcggtc aaatcactag tggcgagtct tggatcgata atcgcaaaga acttgtggtt       600
     atgcatatcg ccttcaaggg cagtacggct tacataaacg atctgaaagc attcttgtct       660
     ggtttgcgtt cactgtcact aaatggcagg agggtgactg ctgtcgctct gcccgatcta       720
     aacgcatcgc agaagctgtc tcgtacgcgg cgggcaccgg aacacacggc gcttgacacc       780
     acttttagtt gggataggga cgagcggctc atgatagctg atcaacacgc acaagcgtcg       840
     ctctcccttg gccccgtttg ttacgcgtcg aattcttctt gcaatgatgc gacagacact       900
     tgctcgggac atggtgcctg ctacgagaaa tccggtggct gctatgcttg cctttgccac       960
     gatacatatg ttaagaccgc aagtggaacg gagcggaaga tacgatgggg gggctctgct      1020
     tgccagaaaa gggatattag cagcccgttc tttctcatca tgggggtcac tgtagcagta      1080
     ctgttggcgg tcatttctgc tattgcgatg atatttggta tagggaacga tgaattacca      1140
     ggcgttatca gtgctggtgt gggaactgtt agggcacaga agtag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page