(data stored in ACNUC16935 zone)

EMBL: BN001307.PE223

BN001307.PE223       Location/Qualifiers
FT   CDS_pept        join(626156..626280,626334..626623,627022..627425)
FT                   /locus_tag="ANIA_09423"
FT                   /old_locus_tag="AN9423.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008009"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008009"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008009"
FT                   /db_xref="GOA:C8VLV9"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV9"
FT                   /protein_id="CBF84780.1"
FT                   /translation="MPPSRPLLYSHQSVLQIHPSRRYFSHGPNVRYVKVIKRPWSRGFI
FT                   ANILLCGIAAYFWSSFVPARKDNTSSNTASQTTVDSHSAPETTSRDRIEAVFIPTGWSH
FT                   LEEGRLYAATDPEWKEFVKISQSPEKLQSLKGNLLSERACLSDSYMDFKTLDKLGGASQ
FT                   SESPSTHLQPSSILATLRWLPLPKLGPGSDLHDATQVFKKRIDECQRSDSRAYRQGIFF
FT                   IRGPVGLKGSQGSCRIQVEGEYDPVASQWVSVSMHLNDLAFLSQKPLGRK"
     atgccgccct caaggccact cctttatagt catcaatcag tgttacagat tcatccgtca        60
     cgccgctact tttcgcatgg acccaacgtt cgatatgtaa aggtgatcaa acgaccttgg       120
     tccagaggct tcatcgcaaa tatattgctc tgtggaatag ctgcatattt ctggagctca       180
     tttgttccgg ctcgaaagga taatacgtcc agcaatacgg cctcgcagac aactgttgac       240
     agtcattctg cacctgaaac aacaagccga gaccgtatag aggctgtatt cattccaact       300
     ggatggtcac atctggaaga aggcagatta tatgcagcaa cagaccctga gtggaaggag       360
     tttgtcaaaa tctcccaaag ccctgaaaag cttcagtcgc tcaaaggtaa tctattaagt       420
     gagcgggcgt gcttgtcaga ctcatatatg gacttcaaga ccttggacaa gcttggtggc       480
     gcgtcgcaat ccgagtcgcc gagcacgcat ctccagcctt catccatttt ggctacattg       540
     cgatggctac ctctgccaaa actaggccct ggttctgatc tacacgacgc gacgcaggtt       600
     ttcaagaaac ggattgacga gtgccagaga tcggactcac gtgcttatcg tcagggaata       660
     ttcttcattc gtgggcctgt gggcctcaag ggctcgcagg gttcctgcag aatccaagtg       720
     gagggcgaat atgatccagt agcctcacag tgggtatctg tttctatgca cctcaacgat       780
     ttagcgtttc taagccaaaa gcctttgggt cgcaaatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page