(data stored in ACNUC16935 zone)

EMBL: BN001307.PE224

BN001307.PE224       Location/Qualifiers
FT   CDS_pept        complement(join(628850..628982,629107..629165,
FT                   629213..629357,629403..629506))
FT                   /locus_tag="ANIA_09424"
FT                   /old_locus_tag="AN9424.4"
FT                   /product="cell cycle regulatory protein Cks/Suc1, putative
FT                   (AFU_orthologue; AFUA_8G03920)"
FT                   /note="transcript_id=CADANIAT00008010"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008010"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008010"
FT                   /db_xref="GOA:Q5AQK6"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="InterPro:IPR036858"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK6"
FT                   /protein_id="CBF84782.1"
FT                   /translation="MDIDPSRRNKKPRPLLESERERLDEFIDSIHYSARYSDDQFEYRH
FT                   VQLPKNMLKKIPADYFDSSKGTLKLLWEEEWRALGITQSLGWEHYEVHEPEPHILLFNV
FT                   YTGVDSPDTEEEPSRRAAIQCTLECSRQFKTPCNEFDKWNMV"
     atggacattg acccaagccg gaggaacaag aagcctcgcc ctttgttgga atccgagcgt        60
     gagcgactgg acgagttcat cgactctatc cattattcag caagatactc tgatgatcaa       120
     tttgaatatc gccatgtcca gctgccgaag aacatgctga aaaaaatacc tgccgactac       180
     tttgacagtt ccaaagggac cctcaaatta ttatgggaag aagagtggcg agctcttggt       240
     atcacacaga gtctgggctg ggaacattac gaagttcatg aaccagagcc gcatattctt       300
     ttgttcaacg tttacacggg cgtcgacagt ccagacaccg aggaagagcc atctcgacgt       360
     gccgctatcc aatgcacatt agaatgctcc cggcaattca aaactccgtg caatgagttc       420
     gataaatgga atatggtatg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page