(data stored in ACNUC16935 zone)

EMBL: BN001307.PE225

BN001307.PE225       Location/Qualifiers
FT   CDS_pept        join(630498..630540,630593..630643,630696..630822,
FT                   630872..631037,631090..631323,631386..631442,
FT                   631509..631949)
FT                   /locus_tag="ANIA_11227"
FT                   /old_locus_tag="AN11227.4"
FT                   /product="heat shock 70 kDa protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008011"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008011"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008011"
FT                   /db_xref="GOA:C8VLW1"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW1"
FT                   /protein_id="CBF84784.1"
FT                   /translation="MSDEVYEGAIGIDLGTTYSCVANYEGTNVEIIANEQGSYTTPSFV
FT                   SFTDKERLIGEAAKNQAAMNPQNTIFDIKRLIGRRYEDPIVKKDVESWPFKVVDQGGNP
FT                   AVEVEYLGETKTFTPQEISSMVLMKMKEVAETKLGKKVEKAVITVPAYFNDNQRQATKD
FT                   AGAIAGLNVLRIINEPTAAAIAYGLGSGKSEKERNVLIYDLGGGTFDVSLLNIQGGVFT
FT                   VKATAGDTHLGGQDFDTNLLEHFKKEFQKKTGKDLSGDSRALRRLRTACERAKRTLSNA
FT                   TQTSVEIDSLFDGEDFNTSITRARFEDLNAKSFSGTLEPVQQVLKDSGLAKNQVDEIVL
FT                   VGGSTRIPRIQKLLSDFFDGKKLEKVSFLCHC"
     atgtctgacg aggtttatga gggcgccatt ggcattgacc ttggcacaac ctactcctgt        60
     gttgccaact acgaaggcac aaatgtggaa atcattgcca atgaacaggg tagttacaca       120
     accccctcgt tcgtctcttt caccgacaag gagcgcttga ttggtgaggc ggccaagaac       180
     caggctgcca tgaaccctca gaacactatc ttcgatatca agcgtcttat cggtcgccgt       240
     tatgaggacc ccattgtcaa gaaggatgtc gaatcttggc ccttcaaggt cgtcgaccag       300
     ggcggaaacc ctgctgttga agtcgagtat ctcggagaga ccaagacttt cactcctcag       360
     gaaatctcgt ccatggttct gatgaagatg aaagaagttg ccgagaccaa acttggcaag       420
     aaggttgaga aggccgtcat tactgtcccc gcttacttca acgacaacca gcgtcaagcc       480
     accaaggatg ccggtgccat cgctggtctc aacgtccttc gtatcattaa cgaacccacc       540
     gccgctgcta tcgcctacgg ccttgggtct ggaaagtccg agaaggagcg taacgttctc       600
     atctacgatc ttggtggtgg taccttcgac gtttcgctac tcaacattca aggtggcgtt       660
     ttcaccgtta aggccacagc tggcgacaca catcttggag gacaggattt cgatacgaat       720
     cttcttgagc acttcaagaa ggaattccag aagaagaccg gcaaggacct ctccggcgat       780
     tccagggccc ttcgtcgtct tcgaaccgct tgcgagcgtg ccaagcgcac cctctcaaat       840
     gccactcaga ccagtgtcga gattgactca ttgtttgatg gtgaagattt caacacctct       900
     atcacccgtg ctcgctttga ggatctgaat gccaagtcgt tctccggtac tcttgagccc       960
     gttcagcagg ttcttaagga ctccggcctt gccaagaacc aggtcgacga gatcgtgctt      1020
     gttggtggtt ctacccgtat tcctcgcatc cagaagctcc tcagcgactt tttcgatggc      1080
     aagaagctcg agaaggtcag tttcttgtgc cactgttaa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page