(data stored in ACNUC16935 zone)

EMBL: BN001307.PE226

BN001307.PE226       Location/Qualifiers
FT   CDS_pept        join(631503..631925,631975..632455,632506..632774)
FT                   /locus_tag="ANIA_10202"
FT                   /old_locus_tag="AN10202.4"
FT                   /product="Heat shock protein 70
FT                   [Source:UniProtKB/TrEMBL;Acc:O42808]"
FT                   /note="transcript_id=CADANIAT00008012"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008012"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008012"
FT                   /db_xref="GOA:C8VLW2"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW2"
FT                   /protein_id="CBF84786.1"
FT                   /translation="MQAGDTHLGGQDFDTNLLEHFKKEFQKKTGKDLSGDSRALRRLRT
FT                   ACERAKRTLSNATQTSVEIDSLFDGEDFNTSITRARFEDLNAKSFSGTLEPVQQVLKDS
FT                   GLAKNQVDEIVLVGGSTRIPRIQKLLSDFFDGKKLEKSINPDEAVAYGAAVQAGILSGK
FT                   ATSAETQDLLLLDVVPLSLGVAMEGNIFAPVVPRGQTVPTIKKRTFTTVVDNQTTVQFP
FT                   VYQGERTNCADNTSLGEFTLAPIPPMRAGEAALECVFEVDVNGILKVTATEKSSGRSAN
FT                   ITISNAVGKLSTTEIEQMIDDAAKFKTSDEAFTKRFESRQQLESYISRVEEIISDPTMS
FT                   MKLKRGNREKIESALSDAMAQLEIEDSTPEDLKKKELALKRLITKAMATR"
     atgcaggctg gcgacacaca tcttggagga caggatttcg atacgaatct tcttgagcac        60
     ttcaagaagg aattccagaa gaagaccggc aaggacctct ccggcgattc cagggccctt       120
     cgtcgtcttc gaaccgcttg cgagcgtgcc aagcgcaccc tctcaaatgc cactcagacc       180
     agtgtcgaga ttgactcatt gtttgatggt gaagatttca acacctctat cacccgtgct       240
     cgctttgagg atctgaatgc caagtcgttc tccggtactc ttgagcccgt tcagcaggtt       300
     cttaaggact ccggccttgc caagaaccag gtcgacgaga tcgtgcttgt tggtggttct       360
     acccgtattc ctcgcatcca gaagctcctc agcgactttt tcgatggcaa gaagctcgag       420
     aagagcatca accccgatga ggctgtcgcc tatggtgccg ccgttcaggc cggtatcctc       480
     tccgggaagg caacttcagc cgagactcag gatctcctcc ttctggatgt tgttcctcta       540
     tctcttggtg tcgcgatgga aggtaacatc ttcgctccag tcgttcctcg cggccagacc       600
     gtccccacta ttaagaagcg taccttcact actgtggttg acaaccaaac cactgtgcag       660
     ttccctgtct atcagggtga gcgtaccaac tgcgccgaca acacttctct tggagagttc       720
     actttggctc ccatcccacc tatgagagct ggagaggctg ctctggagtg tgtcttcgag       780
     gttgatgtca atggtatcct caaggtcacc gccactgaga aatcttctgg ccgcagcgcc       840
     aatatcacta tctcaaacgc tgtcggcaag ctttctacca ctgagattga acagatgatt       900
     gacgatgctg ccaagttcaa gaccagtgat gaggccttca ccaaacgatt tgagtcccgt       960
     caacagctcg agtcctacat ctctcgcgtt gaggaaatca tctccgaccc tacaatgtct      1020
     atgaaactca agcgtggcaa cagggagaag atcgagtctg ccctcagtga tgccatggca      1080
     cagctcgaga ttgaggattc cactcccgag gatctcaaga agaaggagct ggctctcaag      1140
     agactcatca ctaaggccat ggccacgcgg taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page