(data stored in ACNUC16935 zone)

EMBL: BN001307.PE228

BN001307.PE228       Location/Qualifiers
FT   CDS_pept        complement(join(634143..635053,635166..635286))
FT                   /locus_tag="ANIA_01405"
FT                   /old_locus_tag="AN1405.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008014"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008014"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008014"
FT                   /db_xref="GOA:Q5BDH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDH5"
FT                   /protein_id="CBF84789.1"
FT                   /translation="MLQSRAMILHPWRLRRVVPSFSSIRQLSTSGALGADSSPADESKL
FT                   RVSTATPRKNEPKKLKIPPVLLKLNNSNVDRLRPRRIIDARSLAASKSSGGLPTNVLRG
FT                   PRRLGAQGGTSLRGRKPFNAKPAPRAPRRARQRDSAGEDENPSLTAELEDVYRELAEKT
FT                   KPTATRYEPQAPSLQSLSETWPSLPTDVTATAAGVAEKLSLLSERYPNGYVPPYTLGKR
FT                   LIEGKYVRFTSEAERIEALEAAKKFAQEAADKLSQEKGELIEPQAVKFQGAKGGEYKTL
FT                   IESLAQGKYPTVETVSTDKPPVVGEILRNIRNNESYQAPGKKAQFMAKLETLLVPNRAV
FT                   KRP"
     atgcttcagt cccgagctat gatactacac ccatggcgtc tgaggagggt agtgccatca        60
     ttctcctcaa tccgacaatt gtccacatcc ggggcactgg gagcagattc atctccagca       120
     gatgaatcaa agcttcgtgt ttcaaccgcc actccacgga aaaatgagcc gaagaagctg       180
     aagattccac cggttctcct aaagctcaac aactcgaatg tagacaggct ccgccctcgc       240
     cggattattg atgcgaggtc tcttgcggcc tcgaaatcat cgggcggcct gccaacaaac       300
     gttcttagag gcccacgccg cctaggagct cagggaggaa cgtcattacg cgggcggaaa       360
     ccgttcaatg cgaagccggc accgagagca cctcgccgcg cgcgtcaaag ggactcggct       420
     ggagaagacg aaaatccgtc gctgacggca gaacttgaag atgtctaccg agaacttgca       480
     gagaagacaa agccgactgc cactcgctat gaaccccagg cgcccagctt gcagagtttg       540
     agcgagacat ggccatcact gcccacagat gtcacagcga cggctgctgg agtcgctgaa       600
     aagctctccc tgcttagtga acgctatccc aacggttatg tcccacccta cacactgggt       660
     aaacgactca tcgaggggaa atatgtccgg tttacaagtg aagcggagag aattgaggct       720
     ctagaagcag ccaagaagtt tgcgcaggag gctgcggata agttgtcaca ggaaaagggc       780
     gagctcatag agccgcaagc ggtcaaattc caaggtgcta agggcgggga gtacaagacg       840
     ctgattgagt ctctcgcgca aggaaaatac cccacagtgg aaacggtgtc gacggacaag       900
     ccacctgttg tcggcgagat tctccgcaat ataaggaaca acgagagtta ccaggctcct       960
     ggaaagaagg cccaattcat ggccaagcta gagacgctcc tggttccgaa ccgcgccgtc      1020
     aagcgtcctt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page