(data stored in ACNUC16935 zone)

EMBL: BN001307.PE23

BN001307.PE23        Location/Qualifiers
FT   CDS_pept        complement(join(62473..63050,63097..63161,63211..63602,
FT                   63693..63800,63846..64007))
FT                   /locus_tag="ANIA_11159"
FT                   /old_locus_tag="AN11159.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007814"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007814"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007814"
FT                   /db_xref="GOA:C8VKR0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKR0"
FT                   /protein_id="CBF84412.1"
FT                   /translation="MYETLPLVGHSLAIFVVAAVMVGFSIVAVFLRCFVRVYLVRAFGW
FT                   DDALMLTALALFIALCALCMLAPAAGVGHKVSDFMSLDQLQRALKLWWLGQMLYLWASA
FT                   VAKIAIALALLRLAVRRLHRFILWTICAVVVVIGLVFWLVLLFDCWPVEYFWEQTDIRK
FT                   QGKCISTEILLIIAYCYSSLTIVCDIMLGILPACLIWSLQMSRRTKLALVGVLSLGAIA
FT                   SVAVVIRLPYLENYADPDFLYSTYQIAIWSVVETGLAIIAGSLITLRPLFRWFLDGSSS
FT                   YKHQHTPQQKTNKKYVLSTLTANASMPGIEDPKYWRPDLGEDPHTVVTSIMAPLGRSMD
FT                   DNSTVALSPILPPPRKISVCVHQTFAVYKDPSSPVASSFGCPGQCSPAPVPASIQSATP
FT                   SLIPTPAPAQAPRLDNGRRYNRGYGAGYAGYTYEF"
     atgtacgaga cgctgcccct ggttgggcac agtctggcaa tcttcgtagt ggcggcggtg        60
     atggtcggtt tctccatcgt cgccgtcttc ctgcgctgtt ttgtccgggt ctacctcgta       120
     cgcgcattcg gctgggacga cgcattgatg ttgacggcgc tggcgctatt tatcgcactg       180
     tgcgctctgt gcatgctcgc acctgctgcg ggcgtgggcc ataaggtctc cgacttcatg       240
     agtctggatc agctgcagag ggcgttgaag ttatggtggc tgggccagat gctctatctg       300
     tgggcatccg ccgttgcgaa gatcgccatc gccctggccc tgctccgact cgccgttcgc       360
     cgtctgcatc gattcatcct ctggacaatc tgcgccgtcg tcgttgtcat agggctggtg       420
     ttctggctcg tcctgttgtt tgactgctgg ccagtcgagt atttctggga acagacagat       480
     atccgcaagc agggcaaatg catatccaca gaaatcctgc tcataattgc atactgctat       540
     agctcgctga cgatcgtctg tgacattatg ctcggcattc tgccagcgtg tctgatctgg       600
     agtctgcaga tgagccggcg gacaaagctt gcattggtgg gagttcttag cttgggcgca       660
     atcgcgagtg tcgccgtcgt catcagattg ccctatctcg aaaactacgc agacccggat       720
     ttcctctact cgacctacca aatcgccatc tggtcggtcg tcgagactgg cctcgctatc       780
     atcgccggca gcctcatcac cctccgtccc ttattccgct ggttcctcga cgggagctcc       840
     tcgtacaaac accaacacac gccccaacag aagacgaaca agaagtacgt cctgtcaacg       900
     ttgactgcga acgcctccat gcctggcatc gaggacccaa aatactggcg acccgatctc       960
     ggggaagatc cacacaccgt agtgacctca atcatggcgc cgctgggacg gagcatggat      1020
     gacaatagca cggtggctct gagccctata ctgccgccgc cgaggaagat ctcggtttgc      1080
     gtgcaccaga cgttcgccgt gtataaagac ccgtcgagtc cggttgcttc gagctttggg      1140
     tgcccaggcc agtgcagtcc agccccggtt ccagcatcaa ttcaatcagc aactccatca      1200
     ttgattccaa ccccggcccc agcacaggca ccgcggttag ataatggacg gcggtataat      1260
     aggggttatg gtgcgggcta tgcgggctat acgtacgagt tctga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page