(data stored in ACNUC16935 zone)

EMBL: BN001307.PE231

BN001307.PE231       Location/Qualifiers
FT   CDS_pept        join(641167..641398,641447..641820)
FT                   /locus_tag="ANIA_01407"
FT                   /old_locus_tag="AN1407.4"
FT                   /product="cytoplasmic protein required for cell viability,
FT                   putative (AFU_orthologue; AFUA_8G03980)"
FT                   /note="transcript_id=CADANIAT00008017"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008017"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008017"
FT                   /db_xref="GOA:Q5BDH3"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR039796"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDH3"
FT                   /protein_id="CBF84795.1"
FT                   /translation="MASEMQNSNPTIINTADLPTRLRPSASPKSSTYGSEFFASALPSL
FT                   TVDALSDYSPSTSESENDDDLMEEPIDEQEIYDLVSTISDPEHPISLGALAVVSLPDIS
FT                   IKPALPDVPDSPLRTVTVLITPTITHCSLATVIGLGVRVRLEQSLPPRFRVNVQIKEGT
FT                   HSTADEVNKQLADKERVAAALENGTLMGVIAKMLETCL"
     atggcttctg aaatgcagaa ctcgaatcca actattatta acaccgccga tcttcctaca        60
     cgccttcggc ccagtgcttc ccccaaaagc agcacgtatg gaagcgaatt ctttgcctcc       120
     gcgcttccct cgctcacggt cgacgctctc tctgactact caccatcgac ctccgagtcc       180
     gaaaacgacg atgacttgat ggaagagcct atagacgaac aagaaatata cgaccttgtc       240
     tcaactatat ctgatcccga acaccccatt tccctgggag ctttagcagt ggtttcgtta       300
     ccagatattt ctattaagcc ggctcttccg gatgtacccg attcgcctct tcgcaccgtt       360
     acagttctca tcaccccgac gattactcac tgcagtttag ccacagtcat aggtcttggt       420
     gtacgtgtcc ggcttgaaca atctctccca ccacggttcc gagtaaatgt gcagatcaag       480
     gaagggacac atagcacggc ggacgaggtg aacaaacagc tcgctgataa ggaaagggtc       540
     gccgcagctc tcgaaaacgg tacgctcatg ggggtgattg caaagatgct tgagacgtgc       600
     ctatga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page