(data stored in ACNUC16935 zone)

EMBL: BN001307.PE235

BN001307.PE235       Location/Qualifiers
FT   CDS_pept        complement(649156..650757)
FT                   /locus_tag="ANIA_10190"
FT                   /old_locus_tag="AN10190.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008021"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008021"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008021"
FT                   /db_xref="GOA:C8VM23"
FT                   /db_xref="InterPro:IPR018791"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM23"
FT                   /protein_id="CBF84802.1"
FT                   /translation="MSCDICTRTQASAFLCATCARNRLYQLRFDSASVILEREYLGQQI
FT                   EAAINADNEHEKCLSGRGNNSAELEEGRPRLWTIQRIKNEQSRSAARIEIVANHIKSLQ
FT                   SRIKDKSLDISQRKIKLTRQRSDSESALYQLSERESGMLSGIQNIIKRTDHLWHANHTK
FT                   TAEARIFLCREAASLYGLRQNVRKNNNGMKETYTIGGVGILDLREMNGKSLPYSGVKQF
FT                   VNTHTGAAPDHISTSFSYIAHILVLVSNYLSLRLPAEITLPHKDYPLPTIYTPSASYLP
FT                   QELRAVPFSDQLPSSRPTSRTALAHASFPRPRPLCIDKSLPKLAKEDPGTYALFIEGVT
FT                   LLAWNVSWLCRSQGLNLGSDSWEDVCDIGKNLWQLLVAPPGQSSALIATRKGSYQTRAH
FT                   KDFPRTMIQRTKSFPMLGHYSHGTAHSFLGASEGTEFVRNWKLPSPTKVVDGLKSTLLG
FT                   EMASAEWELLEENEWDDSRQPVSHESSHGSDLPHDDQSSYTSDTITLAPKLGAPDAPAI
FT                   AARSKGTSGWTKLRHR"
     atgagctgtg acatatgcac tcgtactcaa gcatccgcgt ttttatgcgc aacatgtgct        60
     cggaatcgac tttaccagct acgcttcgat agcgccagtg tcattttgga aagagaatac       120
     ctaggtcagc aaattgaagc tgctataaac gcagacaacg aacatgaaaa gtgtttgagt       180
     ggccggggaa ataatagtgc ggaattggag gagggcaggc cccgactctg gaccattcag       240
     aggattaaaa atgagcagtc acggtcagca gcgagaatag aaattgtcgc gaaccatatc       300
     aaaagcctcc aatctcggat caaagataag agtctcgaca tatctcaacg caagataaag       360
     ttaacgcgac aacggtccga ctctgaatct gctctatacc agctgtcaga acgagagtcg       420
     ggaatgttga gcggtatcca aaatattatc aagagaacgg atcatctttg gcatgccaac       480
     cacaccaaga cagctgaggc tcggatattt ctctgccggg aggctgctag cctctacggt       540
     ttgaggcaaa atgtgaggaa aaataacaat ggaatgaagg aaacatatac tattggaggt       600
     gtgggtatcc ttgaccttcg ggaaatgaat gggaagtctc taccttactc tggtgtgaag       660
     caatttgtta atactcatac aggcgccgca cctgaccata tctcgacgtc gttttcctac       720
     attgcccaca tccttgttct tgtttccaac tatttatcac tgcggctccc ggcagagata       780
     acgcttcctc ataaggacta tccgttgccc acaatttaca caccctctgc atcatatctt       840
     ccacaggaat tacgtgccgt gccgttttcc gaccagttgc cgtcttcgag gccgacatcg       900
     cgcacagcat tggcacacgc ttcttttccc cggccacggc ctctctgtat tgacaaatct       960
     cttccaaagt tagccaagga ggatcctggg acttatgctc tcttcatcga aggggtcaca      1020
     ctgctggctt ggaatgtgtc ttggctttgt cgtagtcaag ggctcaatct agggtccgat      1080
     tcctgggaag acgtctgcga tattgggaag aacctgtggc agcttcttgt ggcgcctccc      1140
     gggcagtcat ctgctctgat cgcaacccgc aagggctctt accaaaccag agcccacaaa      1200
     gatttcccga ggaccatgat tcagcgaaca aagtcctttc caatgcttgg tcattattca      1260
     catggcaccg cacactcttt cttaggtgca tctgagggga cagagttcgt ccgaaattgg      1320
     aagcttccat ctccaacgaa ggttgttgac gggttgaagt caactcttct tggtgaaatg      1380
     gctagtgcag agtgggaatt gcttgaagaa aatgaatggg acgattctcg gcaaccagtt      1440
     tcccacgaat cttcccatgg ctcagacttg ccgcacgatg atcagtctag ttatacctca      1500
     gatacaataa ctttggcacc taaacttggt gcgcctgatg cccccgccat tgcggctcgc      1560
     tcaaaaggga ccagcgggtg gactaaactt agacataggt ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page