(data stored in ACNUC16935 zone)

EMBL: BN001307.PE236

BN001307.PE236       Location/Qualifiers
FT   CDS_pept        join(651511..651744,651820..651878,651910..651974,
FT                   652025..652089)
FT                   /locus_tag="ANIA_01411"
FT                   /old_locus_tag="AN1411.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008022"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008022"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008022"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG9"
FT                   /protein_id="CBF84804.1"
FT                   /translation="MASGDKTPSRLPGPKSGIARSKPMLREQSVTSGDEESQLKDSIKD
FT                   FDWSQLESVYIQMMEQHEKSEEELRNHITRLLQTTVVHDESRAVKRLVVSFRRFRTQMH
FT                   HVQNSEESLEKKRRHYMDVVNAFERALALLNDRAKP"
     atggcatccg gcgataaaac accttctcgt cttcctggcc ccaaatctgg aattgctcgg        60
     agcaaaccca tgctcaggga gcagtctgtt acctcaggag atgaagaatc gcaactcaaa       120
     gacagtataa aagactttga ctggtcccag ctcgaaagcg tttacataca aatgatggaa       180
     cagcatgaga aatccgaaga agagctccgc aaccatatta cgagactgct ccagactacc       240
     gttgtacacg acgaaagcag agccgtgaaa aggttggttg tctctttcag aaggttcaga       300
     acgcagatgc accatgtcca gaattctgaa gagagtctgg agaagaagag aagacactat       360
     atggatgttg tcaatgcatt tgagcgtgca cttgcacttt tgaatgatcg tgcgaaacct       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page