(data stored in ACNUC16935 zone)

EMBL: BN001307.PE238

BN001307.PE238       Location/Qualifiers
FT   CDS_pept        join(654515..656420,656492..656751,656797..656964,
FT                   657012..657341,657389..657584,657690..657765,
FT                   657811..658264,658309..658456,658508..658989)
FT                   /locus_tag="ANIA_01413"
FT                   /old_locus_tag="AN1413.4"
FT                   /product="Protein cft1 (Cleavage factor two protein 1)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG7]"
FT                   /note="transcript_id=CADANIAT00008024"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008024"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008024"
FT                   /db_xref="GOA:Q5BDG7"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDG7"
FT                   /protein_id="CBF84808.1"
FT                   /translation="MQCYTELISPTGVTHALAVPFLSATANNLIVARTSLLQIFSLRDV
FT                   SLSALDTEVRPAQHRQETCKLVLEREYQLPGTVTDICRVKILKTKSGGDAVLVAFRDAK
FT                   LSLVEWDPERYGLSTISIHYYERDDMTRSPWASDLSTCGSILSADPGSRCAIFQFGARS
FT                   LAIIPFHQPGDDLVMDDFGSEPDYENRVEGNSRSHEAKDKDAAEYQTPYASSFVLPLTA
FT                   LDPSVIHPISLAFLYEYREPTFGILYSQVATSHALLHERKDVVFYTVITLDLEQRASTT
FT                   LLSVTRLPSDLFKVVALPPPVGGSLLIGSNELVHIDQAGKTNAVGVNEFSRQASSFSMT
FT                   DQSDLALRLENCVVERFSDDNGDLLLALSTGVFALVSFKLDGRSVSGISVRPLSGPSKE
FT                   FLASTASSSAFLGNGKVFFGSESADSVLLGWSSASSATKKSFSGSTSNDESEDDAYEDD
FT                   LYSSAPAAMTDNPQNQPSNSSVAAFGDLRIHDRLSSPGPIRDIVLGRSSEASSRDTKDG
FT                   VLELVAAQGSDEGGTMVIMKREVDPYLVASMAADTANSLWTVSLLPDNNDQKRDYVILS
FT                   KQEKPDKEESEVFVLEDKLRPITAPEFNPNHELTVEIGTLASKSRVIQVLRNEVRSYDA
FT                   VWDEDDSDERVAVNATLVDPYLAIIRDDSTLLLLQADDSGDLDEVTLSEDVVSQKWLSA
FT                   CFYSDNAGFFTAPFASILFLLNQDHQLYVYRLPDFAVISVIEGVGCLPPILSTEPPKRS
FT                   TTRENVLQIAVVELGDSYSSLPFLILRTENDDLVVYKPFFTNSKELTGLRFLKEANHTL
FT                   PKTPNTTDELQSEMKPLRILPNIAGCSSIFMPGPSAGFIFRASTTSPHFIRLRGGFIKG
FT                   LGCFDSPDKGFAYLDSHGLHLAKLPEGTQLGYPWIMRTVPIGQQIDKLTYVSASDTYVL
FT                   GTCQRCEFRLPEDDELHPEWRNEEISFLPEVNQSSLKVVSPKTWSVIDSYPLEPAEHIM
FT                   VMKTMSLEVSENTHERRDMIVVGTSLARGEDIPSRGCIYVFEVIEVVPDPEQPETNRRL
FT                   KLIGKEPVKGAVTALSEIGGQGFLIAAQGQKSMVRGLKEDGSLLPVAFMDMQCFVSVIK
FT                   ELKGTGMCIFGDAVKGLWFAGYSEEPYKMSLFAKDLDYLEVLAADFLPDGNKLFIVVAD
FT                   SDCNLYVLQYDPEDPNSSNGDKLLNRSKFHTGNFASTVTLLPRTLVSSERAMSGSDKMD
FT                   IDNTAPLHQVLVTSHNGSIGLVTCVPEESYRRLSALQSQLTNTLEHPCGLNPRAYRAVE
FT                   SDASAGRGMLDSNLLLQYLDMSKQRKAEIAGRVGATEWEIRADLEAISGGGLGYL"
     atgcagtgct acactgaatt gatatctccg acaggagtta ctcatgcctt ggcagttcct        60
     tttctttcag cgactgctaa caacctgatc gtcgcccgga cttcgcttct tcaaattttc       120
     tctttacgcg atgtgtcatt gagtgcactt gatacggaag ttcgaccggc gcaacacagg       180
     caggaaacgt gcaagctggt cttggaaagg gaatatcaac tgccaggtac agtaactgat       240
     atctgtcggg taaagatttt gaagacaaag agcggcggag atgcagttct tgtggccttc       300
     cgagatgcta aattgagctt ggttgaatgg gacccggagc gctacgggtt atccactatt       360
     tctatccact actacgagcg tgatgatatg acccgtagtc catgggcgtc tgatttgagc       420
     acttgcggca gtatcttgag cgccgacccg ggcagtcgat gcgcaatttt tcaattcggc       480
     gcacgaagtc ttgctattat accttttcac cagcccgggg atgacttagt gatggacgac       540
     tttggctccg aacctgacta cgagaatagg gtagaaggga attcgagaag tcatgaagct       600
     aaagataaag acgccgctga gtaccaaact ccgtatgcgt cgtccttcgt cttgcccttg       660
     actgcgttgg acccttcagt catccatccc ataagtctgg ccttccttta cgaatacagg       720
     gagccgacct ttggcatatt gtactcgcaa gttgctactt cacatgccct acttcacgaa       780
     cgaaaagatg ttgtttttta tacggtcatt acgcttgatt tagaacaacg tgcctctaca       840
     accttgcttt ctgttactag actacctagc gacctgttta aagtggtagc tctcccccct       900
     cctgtaggag gatcgctact tatcggatcc aacgaactcg tgcatatcga ccaggcaggg       960
     aaaaccaatg cagttggggt caatgagttc tctaggcaag catcttcgtt ttccatgacc      1020
     gatcaatccg acctggccct tcgtctcgag aattgcgtcg tggagcgctt ttctgacgat      1080
     aatggtgacc ttcttttggc actctcgacc ggggtattcg ctctggtaag cttcaagctt      1140
     gatggaaggt cagtatctgg tatatctgtt cggcccttgt ccggtccgtc aaaagagttc      1200
     ctggcttcga ccgcatcgtc ttcagctttc ctaggcaacg gcaaggtctt ctttggcagc      1260
     gagagcgcgg attctgtcct gctaggctgg tcttctgcct catcagccac aaagaaatcc      1320
     ttctctggga gcacttcaaa cgatgaaagt gaagatgacg cttacgaaga cgatctatac      1380
     tcttctgcgc ctgctgccat gacagacaat cctcaaaatc aaccgagcaa ttcgtctgtc      1440
     gctgcgtttg gtgatttgcg aattcacgac aggctttcca gccctggtcc tatcagagac      1500
     attgtgctcg ggaggagctc tgaagcgtct tcgcgtgaca caaaagacgg cgtgctagag      1560
     ctagtggcag ctcaaggctc ggatgaaggt ggtacaatgg tgattatgaa gcgggaggtt      1620
     gatccgtatc ttgtagcatc aatggctgca gacacagcaa actccctctg gacagtctct      1680
     ttgctaccgg ataacaatga tcaaaaacgt gactatgtca tactgtcaaa gcaggagaaa      1740
     cctgacaaag aggagtccga ggtgtttgtg ctagaggata aactcaggcc aattacggcg      1800
     cctgaattta atccgaacca tgaattgacc gtagaaatcg gtaccttggc cagcaagagt      1860
     agggtaatcc aggtattgag gaacgaggtg cgaagttatg atgctgtatg ggacgaggac      1920
     gatagtgatg agagagtagc tgtcaatgct actctcgtgg acccttactt ggcgatcata      1980
     cgagacgatt caaccttact actactacag gccgatgaca gcggagacct tgatgaagtg      2040
     acattgagcg aggatgtcgt aagtcaaaag tggctgtctg cctgcttcta cagcgataat      2100
     gctggtttct tcactgctcc ttttgcttcg atcctgttcc tattgaacca ggatcatcag      2160
     ttatatgtat accgactgcc cgactttgcc gtgatatcag ttattgaagg agtaggctgt      2220
     ttaccgccta tcctgtccac cgagcctccc aagcgatcta ctacgcgtga aaatgtatta      2280
     caaatcgctg ttgtggagct tggtgactct tacagcagcc tgcccttttt aatccttcga      2340
     actgaaaatg acgacttggt tgtgtataag ccgttcttca ctaactcaaa ggagctgact      2400
     ggcttgagat tcctgaaaga agcaaaccat acacttccaa agactcccaa tacgacagac      2460
     gagttgcaat cagaaatgaa acctcttcgc atcttaccga acattgcggg ctgtagtagc      2520
     attttcatgc ctgggccttc agcgggtttc attttccgag cttcaactac ctcgccccat      2580
     tttattcgcc taagaggtgg ttttatcaag gggctaggtt gttttgattc tccagataaa      2640
     ggattcgctt accttgactc gcatggcctt catttagcta aacttccaga agggacacag      2700
     cttggctacc catggataat gagaacggtt ccaatagggc agcaaattga caaactgaca      2760
     tacgtgtctg cttccgacac gtatgttctc gggacatgtc agagatgcga atttagattg      2820
     cccgaagatg acgaattaca tccagaatgg cgtaacgaag aaatatcctt tttgcccgag      2880
     gtaaaccaaa gctcgctcaa ggtcgtgagt ccgaaaacgt ggtctgttat tgacagttat      2940
     ccactggagc ccgctgagca tataatggtt atgaaaacca tgagcttgga agtctctgag      3000
     aatacacatg aacgcagaga tatgattgtg gtgggaacat cgctggctcg cggagaggat      3060
     ataccatcac gcggttgtat atatgttttc gaagttatcg aagtagttcc tgacccagaa      3120
     caacctgaga cgaatcgcag gctgaaactt attggcaagg agcctgtgaa gggagctgtg      3180
     actgcgctgt ccgagatcgg tggccaaggc ttcctcattg ctgcgcaggg ccagaagagc      3240
     atggtcagag gtctgaaaga ggacggaagc cttctgcctg ttgcatttat ggacatgcag      3300
     tgctttgtta gcgtgatcaa ggaactcaag ggaaccggaa tgtgtatttt tggagacgca      3360
     gtgaagggtc tctggttcgc aggctattca gaggagcctt ataagatgag cctttttgca      3420
     aaagaccttg attatctcga ggtactggca gcagactttc tccccgacgg caacaaacta      3480
     ttcattgtcg ttgccgatag cgattgcaat ctctacgtac ttcagtacga ccctgaagat      3540
     ccaaactcgt ccaatggcga caaactgctg aaccgcagca aattccacac cggaaacttt      3600
     gcctccaccg taacccttct gccacgaacc ctagtctcct ccgagcgcgc catgtccggc      3660
     tctgacaaaa tggatattga caacacagca cccctccacc aagttctcgt cacctcccac      3720
     aatggctcta tcggcttagt gacctgcgtc cctgaggaat cctaccgccg cctctcagcc      3780
     ctccagtccc aacttacaaa cactctcgag cacccgtgtg gtcttaatcc tcgtgcctac      3840
     cgcgccgttg agagcgacgc cagcgccggt agaggcatgc tcgacagcaa tctgctcctc      3900
     cagtacctgg acatgagcaa gcagcgcaag gctgagattg cgggaagagt tggcgccacg      3960
     gagtgggaga ttcgggctga tcttgaggcc atcagtggtg gaggactcgg gtatctttga      4020
//

If you have problems or comments...

PBIL Back to PBIL home page