(data stored in ACNUC16935 zone)

EMBL: BN001307.PE239

BN001307.PE239       Location/Qualifiers
FT   CDS_pept        complement(join(659824..659898,659955..661500,
FT                   661559..661704))
FT                   /locus_tag="ANIA_01414"
FT                   /old_locus_tag="AN1414.4"
FT                   /product="Protein pacG (Nonrepressible acid phosphatase
FT                   regulator pacG) [Source:UniProtKB/Swiss-Prot;Acc:Q05534]"
FT                   /note="transcript_id=CADANIAT00008025"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008025"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008025"
FT                   /db_xref="GOA:Q05534"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR024061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05534"
FT                   /protein_id="CBF84810.1"
FT                   /translation="MEGFDTMALPYLASPLSLGNMQGTDYLNALQGMDLPDQRSNFDSE
FT                   TFVSGDDLTFAHLSPQTLKRFSSGYEDSFPEMVTSFDPPPPAEPPADSSIDHNNKLLSF
FT                   SMPVYPWTLLDYSFRRASISISAQLHGMFFLAESPWTTSPTENAPPQQGAELTCYRRNL
FT                   FQITGSVTLPRALRYIITDTGDRIPIVAHELTVSATESVEGNSVKIISVPWKTPAANDA
FT                   GKDTGNSSNTAAKVEKEPPAIPLDMLTGQDLDADYATFPIAWKRLQFRVATANNGRRKE
FT                   LQQHFVVRLRVVATLSTGMKTPICEVHSGPVIVRGRSPRNFQSRKDLPLSGSAAASRKN
FT                   AQAAAASNNLTRTSPSLTDKAKTVVKSSSPETSSNGVPQQSPPNWALATNSTLPPPTTT
FT                   TLPHSSVYSQSSPEFSRPVEAHRRTTSAIAAPINLSLLDDDSLNLSNGDSRPHTSFSND
FT                   LASKSLSVDSGRPVKMRKVSHSMPQAQSRSTSATFLNTANFQQMLPVPFTSESADVLYE
FT                   YFPLGLEDWQGPVDAVYRPHVVHHTNMPQMKYITARGQSKRYFAAEDSYSLVEAICPSG
FT                   WTYSRIISRTMI"
     atggagggct tcgacaccat ggcgttgccc tatctggctt ccccgctgtc gttagggaat        60
     atgcagggca cagattatct caatgctttg caaggcatgg accttcctga tcaacgatca       120
     aactttgact ccgagacatt cgttagcgga gacgatttga cctttgccca tctatctcca       180
     cagacactga agcgattctc ttccggttac gaggactcgt tcccagagat ggtcacttcc       240
     tttgaccccc cgcctccagc tgagccgcct gccgactcct ccattgacca taataacaag       300
     ctattgagct tctcgatgcc agtatatccg tggactctgc ttgattattc ttttcgacgc       360
     gcctcaatat caatttcagc tcagctgcac ggcatgtttt tccttgccga gtcaccgtgg       420
     accacgtctc cgacagaaaa tgctccgcct cagcaaggag cagaactgac ctgctaccgg       480
     cgaaatcttt tccagatcac tggttctgta acccttcctc gggccctgcg ctatatcatc       540
     accgacaccg gtgaccggat acctatcgtc gcgcacgaac tgacagtgtc ggctaccgag       600
     tctgttgagg gcaattcggt caagattatt tctgtgccct ggaagactcc cgctgcaaat       660
     gacgctggca aggatacagg aaacagtagt aatactgccg ccaaggtcga gaaggagcct       720
     ccagctatcc cgttagacat gttaactgga caggatcttg atgccgatta cgccactttt       780
     ccaatcgcat ggaagcgtct tcaattccgt gtcgcgactg ccaacaatgg gcgaagaaag       840
     gagcttcaac agcactttgt ggttcggctc agggtcgttg caacattgtc cacgggtatg       900
     aaaaccccga tttgcgaggt tcactcgggg ccagtcatcg tccggggtcg cagtcctcgt       960
     aatttccagt ctaggaaaga tctaccgttg agtggtagtg ctgctgcttc caggaagaac      1020
     gcgcaagcgg ctgcagctag taataatctt actcgaacct cgcccagtct gaccgacaag      1080
     gcaaaaaccg tcgtgaagag cagctctccc gaaacttcat caaacggggt cccccagcaa      1140
     tcccccccaa attgggctct tgcaacaaat tcaacgcttc ctcctccgac gacgacgacg      1200
     ctgccgcact cgtcagtcta ttcgcagtcc agtccagaat tttcgagacc ggtagaggca      1260
     catcgacgga cgacgagcgc cattgctgcc cctattaatt tatctctttt ggacgacgac      1320
     tctctcaatc tctcaaacgg cgattcccgt cctcatacat cattctctaa tgacctcgcg      1380
     tctaagtctt taagcgttga ttcagggagg ccagtcaaga tgcgcaaagt atctcactct      1440
     atgccccaag cgcagtcaag aagcacgtcc gctacattct tgaatacagc caatttccag      1500
     cagatgctgc cagttccttt cacgagcgaa agtgccgatg tgttgtatga gtattttccc      1560
     ttgggcttgg aggattggca aggccccgtt gatgctgtct atcgcccaca tgtggtacac      1620
     cacacgaata tgccccagat gaaatacatt acggcgcgag gtcagagcaa acgatatttt      1680
     gcggcggagg actcatattc tcttgttgag gccatatgtc catctggatg gacatactcg      1740
     agaattattt cacgtacaat gatttga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page