(data stored in ACNUC16935 zone)

EMBL: BN001307.PE24

BN001307.PE24        Location/Qualifiers
FT   CDS_pept        complement(65984..67312)
FT                   /locus_tag="ANIA_09038"
FT                   /old_locus_tag="AN9038.4"
FT                   /product="molybdenum cofactor biosynthesis protein (MoeA),
FT                   putative (AFU_orthologue; AFUA_3G15170)"
FT                   /note="transcript_id=CADANIAT00007815"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007815"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007815"
FT                   /db_xref="GOA:Q5ARP2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP2"
FT                   /protein_id="CBF84414.1"
FT                   /translation="MALSYADAVWLVKTEAQRHASLQRERCSIYSACDRVAAERITSPI
FT                   STPEYDTSAMDGFALSSTATETASPETPVTFNVMATTTAGDRPYPAADSLRDAKDSIPP
FT                   CVEIMTGAPFPTGQEWERFDCSVPIEEVVVQEDRCPPSQRRYVSVCKPARRWQHRRFAG
FT                   GDFTQGDRIIEAGDCIQPQHIMAMASVGLREIPVLRRPRIAVFSTGSELMSDASKAHQF
FT                   MIYDANGPYLTSILRQWGFDVVFRGVLQDDSAAMEESIVRALDYGYDMIVTSGAVSAGR
FT                   CDIIPGLVKRIGGRTVFHKVAVKPGHPILFAMLPPPRETGETAFFGLPGNTVAAAACLR
FT                   FFALPYLRTLQRQSPEEPKAAALRLSNGETEPCNGAAGKVLTFREAPDIFRPAISTQSG
FT                   QVWIIDDHSPGKTRPFLQANCWAHIPSGVSEMRAGSRVDIYPL"
     atggctctat catacgccga tgcagtatgg ctagtcaaga ctgaggccca aaggcatgct        60
     tcgttacaga gagagcgatg ttcgatctac agtgcctgcg accgagtcgc agctgagaga       120
     atcaccagcc ctatttccac ccccgagtac gatacctcgg ccatggacgg atttgccttg       180
     agttctactg caacagagac tgccagtccc gagacgccag tcacgtttaa cgtcatggct       240
     accacgacag ccggcgaccg gccgtatccg gctgcagaca gtctgaggga tgcaaaggat       300
     agcattcccc cctgcgtaga gatcatgacg ggagctcctt ttcctactgg ccaggagtgg       360
     gagcgattcg actgcagcgt cccgattgag gaggtagtcg tgcaagagga ccggtgtcct       420
     ccctcgcaac gccggtacgt ttctgtctgc aaaccagcca gacggtggca gcacagacgg       480
     tttgctgggg gggactttac ccagggcgat cgtataatcg aggccggcga ctgtatccag       540
     ccgcagcata tcatggcaat ggcctcggtg ggtctgagag agattccagt cctgcgcagg       600
     ccccggattg ccgtcttctc gaccggatcc gagttgatgt ctgatgccag caaggcgcac       660
     cagttcatga tctacgacgc caatggccca tacctcactt cgatccttcg gcaatggggt       720
     tttgacgtgg tctttcgcgg ggtccttcaa gacgattcag cagccatgga ggagtcgatt       780
     gtgcgggcgc tagattatgg gtacgacatg attgtcactt ctggcgccgt ctctgctggt       840
     cgctgcgaca tcatccctgg tctagtcaag cgtatagggg gccggacagt cttccataag       900
     gtcgccgtca agcctggcca tccaatcctg ttcgcgatgc tcccgccccc tcgcgagaca       960
     ggcgagacgg cattcttcgg gctgcctggg aacacggtcg cggcagctgc ctgcctccgg      1020
     ttctttgctc tgccatatct caggactctc cagcgacaga gcccagagga gccgaaggcg      1080
     gccgcgctac ggctatccaa cggagaaaca gagccgtgta acggggcggc aggcaaagtc      1140
     ttgacattcc gcgaagcacc agacatcttc cggccggcga tctcgacgca gtctgggcaa      1200
     gtttggatta ttgacgacca cagtcccggc aagacgaggc cgttcctgca ggccaactgc      1260
     tgggcacaca tcccgagcgg agtgtccgaa atgcgagccg gtagtcgcgt cgatatatac      1320
     ccgctataa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page