(data stored in ACNUC16935 zone)

EMBL: BN001307.PE240

BN001307.PE240       Location/Qualifiers
FT   CDS_pept        join(663947..664193,664393..664550)
FT                   /locus_tag="ANIA_01415"
FT                   /old_locus_tag="AN1415.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008026"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008026"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG5"
FT                   /protein_id="CBF84812.1"
FT                   /translation="MPQKDARRQWKRRMRRGLSLPEGPAALSDREKAALDPDKLVDHFS
FT                   FRGAKRGQALAKESQHSSILHLLHRQPTSAARFNLCRRFQRNSPEEPEGKLIRLTADGS
FT                   TPGDDPIGRLFLVPHSSQSLDGHSRLPGVH"
     atgccgcaga aggatgctag aagacaatgg aagcgtcgga tgcgcagggg tttatctctg        60
     cctgaaggtc cagcggcgct ctccgatcgt gaaaaggctg cacttgatcc tgataagctc       120
     gtcgaccact tcagcttcag aggcgccaag cggggtcagg ccctggccaa ggaatcgcag       180
     cattccagca ttcttcatct tcttcatcgt cagccaacga gtgctgcgag atttaatctc       240
     tgccgccgat ttcagcgcaa cagcccagag gaacccgagg gaaaactcat ccgtctcaca       300
     gctgatggaa gcacgccagg agatgatccg atagggcgcc tgttcctggt ccctcacagc       360
     tcgcaatctc tcgatggtca cagcaggcta cctggtgtcc attaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page