(data stored in ACNUC16935 zone)

EMBL: BN001307.PE242

BN001307.PE242       Location/Qualifiers
FT   CDS_pept        complement(join(670899..670935,671011..671145,
FT                   671176..671267,671345..671412,671502..671536,
FT                   671683..671984))
FT                   /locus_tag="ANIA_01417"
FT                   /old_locus_tag="AN1417.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008028"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008028"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008028"
FT                   /db_xref="GOA:Q5BDG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG3"
FT                   /protein_id="CBF84815.1"
FT                   /translation="MVNRPIDVVANSFVNPWLRCTRHPGSAFPVERDTTLSYYWLPALE
FT                   AHEARSFKIAGRDDDDTAECFFGPLKDHYWILSSPNCMTTHINTGLARMMRASLGICRW
FT                   DGTSARSHPQCNPGCEVVFAPSLMTDQQEVRTRDSGRVMLKLQADDNRATEVIFSRNRF
FT                   WILQRQSIRQWSKAVTKLTTFTETVNSVNGAWTEDSYQVVKLIGVRTRSSGANQLALWR
FT                   "
     atggtcaaca ggcccatcga cgtggtggcc aacagctttg tcaacccatg gctccgttgc        60
     actcgccatc ctgggtcagc ctttccggtg gagcgtgaca ctactttgag ctactactgg       120
     ctgcctgctt tggaagctca tgaagctcgg tcctttaaga tagcaggacg ggatgatgac       180
     gataccgcgg agtgcttttt cggccctctg aaagatcatt actggatctt gtctagtcca       240
     aactgcatga ctacccatat caatactggc ttagcaagaa tgatgcgagc gtcattggga       300
     atttgcaggt gggatggtac ctcagccaga agccacccac agtgcaaccc tggctgtgag       360
     gtggtattcg cccccagtct gatgaccgac cagcaagaag tcagaacacg tgattctgga       420
     agagtcatgc tgaagcttca agccgatgac aaccgggcta cggaagtcat attctcaagg       480
     aatcgattct ggattcttca acgccaaagc ataagacagt ggtcaaaagc ggtgaccaaa       540
     ctgaccacct ttacagaaac ggtaaattcg gtaaatggtg cttggactga agacagttat       600
     caagttgtca aactcattgg cgttcggaca aggagctctg gcgcaaatca gcttgcgctc       660
     tggcgctag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page