(data stored in ACNUC16935 zone)

EMBL: BN001307.PE245

BN001307.PE245       Location/Qualifiers
FT   CDS_pept        join(674812..674909,675083..675174,675513..675542,
FT                   675799..675977)
FT                   /locus_tag="ANIA_01419"
FT                   /old_locus_tag="AN1419.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008031"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008031"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008031"
FT                   /db_xref="GOA:Q5BDG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG1"
FT                   /protein_id="CBF84821.1"
FT                   /translation="MSRLLWMASDIQTQNEDACLGIHQLLPSTQCRASLSRVYFPVFKK
FT                   RENLTAHYQGAEAISILGRLREANIQKLDGDNNGSAIPTGAVMTKLLTLSSYGLDIVLF
FT                   QLEPRQHQSRISTDCGVRLINGKVAKSV"
     atgtctaggt tgctgtggat ggcttcagat atccagacac aaaacgagga tgcttgcttg        60
     ggaatacatc aactgttgcc gtcgacgcag tgccgagcgt ctctgtcgag agtctatttt       120
     ccggttttca aaaagcgcga gaaccttacg gcccattatc aaggggcgga agcaatctcc       180
     atattgggga gactgagaga ggccaatatt cagaagcttg acggtgacaa taatggctca       240
     gccattccaa caggtgcagt tatgactaag ttgttgacac tttcaagtta cgggctcgat       300
     atcgtcctct tccaactaga accgcgccag catcaaagca ggatatcgac agattgcggt       360
     gtacggttaa tcaatggcaa ggtagccaag tccgtataa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page