(data stored in ACNUC16935 zone)

EMBL: BN001307.PE246

BN001307.PE246       Location/Qualifiers
FT   CDS_pept        complement(join(676771..678843,678905..679297))
FT                   /locus_tag="ANIA_01420"
FT                   /old_locus_tag="AN1420.4"
FT                   /product="Protein sip5
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG0]"
FT                   /note="transcript_id=CADANIAT00008032"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008032"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008032"
FT                   /db_xref="GOA:Q5BDG0"
FT                   /db_xref="InterPro:IPR039301"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDG0"
FT                   /protein_id="CBF84823.1"
FT                   /translation="MGNSQTKETRPSHSQSSRRSHQWGSGSSHGRSPYGDRHNSEGSRS
FT                   HRSSRPDLSILGLGGSSDRDVATILEHRRETKQEREARRLEKERAARIKERERSMREEH
FT                   VDGGYLVTQGVYTGTEDFNKAIVRQLMIERRLAPFWRGLNDFSDSWTEHQLMAAARGLP
FT                   IPPPDEIPPELEYRNPPKVVEEAKEASNIQSVQHLMVPITSRSASNGSDVSHSSQPAHS
FT                   LPSPSSPIASGTSSSPLFRSRAKTLASLTTSRHNSQVDSTPQEIQLPRDPFVNGQPIEA
FT                   YLYKDAIECPICFLYYPPYLNRTRCCDQPICSECFVQIKRPDPHPPEHADSDSNAPNPA
FT                   GETERQDVQDIQLVSEPAACPFCVQPEFGVAYVPPPFRRGLAYASDSSGRPNIGTPVSS
FT                   TSSLSSATTPTTGRRRATSLSATDPSVITTDKVRPDWAQKLANARAHAARRSAAATALH
FT                   TAAYLMNSNGSGGDTRGFSMRRGVMRRNNGGQDSPGTPGRSGSPALQAFAFLTDRRAPS
FT                   GQETDSAEEGTSNLAPPRNSSRRSRMDDLEEMMMMEAIRLSLASEEERRKREEKELRKE
FT                   AKRREKEAKKAEKMARKAGLYSNNASSSALESPSDSRLPKVTSSSSSIIGEERTPPGKG
FT                   KAVERVTPSQSNVDLTETASSGDVPSSFLEPQQPQSSSSLGPPVPKEPSKPSHLRHVSS
FT                   ASSSFSSLVESMSEEPGLSAQPHEGTSSSAEPLFNFRSLAAVIGDEDKSDEAAEHVEDT
FT                   APHTTSEGSTSSAANLTTAPAGESAVSTSSTAVEKGPTVEESQECSVNKEIETRSMEVT
FT                   DSRNSETTS"
     atgggaaact cgcagacgaa agagacccga ccgtctcact cacaatcgtc ccgtcggagc        60
     caccaatggg gttctggcag cagtcatgga agatccccgt acggtgaccg acacaactcg       120
     gagggttcta gatcgcatcg aagcagcaga cccgatctgt ctattctcgg attaggcggg       180
     agctcagatc gtgatgttgc gacgatactt gaacatcggc gagaaaccaa acaggagcga       240
     gaagctcgtc gtctggagaa ggagcgtgcg gctcggataa aagagcgcga aaggagcatg       300
     agggaggaac atgttgatgg cggttacttg gtaacgcaag gagtctatac agggacggaa       360
     gatttcaata aggctatagt ccgccagttg atgattgaac gccgacttgc gccgttctgg       420
     aggggtctga atgacttctc ggattcatgg actgagcacc aacttatggc ggcagcgcgc       480
     ggcttgccga ttccaccgcc tgatgaaatc cctcctgaac tggaatatag gaatccgcca       540
     aaggttgtcg aggaggccaa agaagcatca aatatacagt ctgttcagca tttgatggtt       600
     ccaataacgt ctcgatccgc atctaatggt tccgatgtat ctcattcatc ccaacccgcc       660
     cattcgctac cttctccctc atcgccgatt gcatccggca catcgagctc gcctcttttt       720
     cgatctcgcg cgaagacact ggcttcttta acaacctcca ggcataactc ccaggttgac       780
     tcgacccctc aagagataca gctgcctcgg gatcctttcg tcaatggcca gcccattgag       840
     gcatatctct ataaggatgc catcgagtgt cccatctgct tcctttacta ccctccctac       900
     ctcaatcgta ctagatgttg cgatcaaccc atctgctccg aatgttttgt gcagattaaa       960
     cgacccgatc ctcatcctcc agagcacgcc gactcggact cgaacgctcc aaatccagca      1020
     ggcgaaacgg aaaggcagga cgttcaagat attcagcttg tctctgaacc agcagcatgc      1080
     ccattttgtg tccagccaga attcggggtg gcatatgtac cccctccttt ccgtagagga      1140
     ctagcctacg cctccgattc gagtggccgg ccaaacatag gaacaccagt gtcatctaca      1200
     tcgtcgctat cttcggcaac tactcctacc actggtcgac ggcgtgcaac atcattatct      1260
     gcaacagatc cgagtgttat aactacagac aaggtgcggc cagattgggc gcagaaactg      1320
     gccaatgctc gtgcacatgc ggcccgaaga tctgcggcgg ctaccgcttt acataccgcg      1380
     gcttatctaa tgaattctaa tggctccgga ggcgatactc gaggatttag tatgaggaga      1440
     ggtgttatgc ggcgcaataa cggtggacaa gactccccgg gtacaccagg tagaagcgga      1500
     tcgccagcgc tacaagcgtt cgctttcttg acagataggc gcgcaccatc tggacaagaa      1560
     acggactcgg ctgaagaggg cacaagcaat cttgctcccc ctcggaacag ttcaagaagg      1620
     tcacgcatgg atgacttgga ggagatgatg atgatggaag ctatccggct gagtctggca      1680
     agcgaagaag agaggcgtaa gagagaggag aaggaattga gaaaagaggc caaaaggcga      1740
     gaaaaagaag ccaagaaagc ggaaaaaatg gctcgtaaag ctggcttata tagcaacaat      1800
     gcgagtagct cggctctgga gtcaccatca gattccagac tgcccaaggt tacaagcagc      1860
     tcttcttcta tcatcggcga agaaagaact ccgccgggta agggcaaggc agtggaaaga      1920
     gtcactccgt cccagagtaa cgtcgacctg accgaaactg ctagctctgg tgatgtaccg      1980
     agcagtttct tagagcctca acaacctcag tcatcctcgt ccctcggccc gccggtaccc      2040
     aaggagcctt ccaagccttc acacctgcgt catgtgtcca gcgcttcctc atcattctcg      2100
     tctctcgtcg agtccatgtc cgaggagcct gggctctcgg cccagccaca cgaaggtacc      2160
     agctcatcag cggaaccatt gttcaacttc cgcagtctag ccgccgttat tggcgacgag      2220
     gacaaatcag atgaagcggc ggaacatgtt gaagacactg cccctcacac gacatcagaa      2280
     gggtcaactt cgagcgcagc gaacctgaca accgctccgg ctggtgagtc agctgtgtca      2340
     acttctagta cggccgtgga aaaaggccct acggttgaag aaagccaaga atgctcggtc      2400
     aacaaggaga ttgagacacg gtccatggag gtcactgata gcaggaattc ggagaccaca      2460
     tcatga                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page