(data stored in ACNUC16935 zone)

EMBL: BN001307.PE247

BN001307.PE247       Location/Qualifiers
FT   CDS_pept        680504..682144
FT                   /locus_tag="ANIA_01421"
FT                   /old_locus_tag="AN1421.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008033"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008033"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF9"
FT                   /protein_id="CBF84825.1"
FT                   /translation="MTSESSATTRLHITPLNPELIPSVLPASVRSLASDISFHGIPTFP
FT                   ENNYGYVTLPKMEAEKLKKKLNGSILKGRKFKVEPARPQKRQAEEGDEQNFTSTDNPSV
FT                   TVKSKKRKAEENVLSGYELPSDRKVKRGWTESTTDKTERRKKEKRSKDKQEKKAKTQLK
FT                   SKYTEKPECLFRTKVPPNKSALAEEKSKKQPKKKKTSPESVVHEFAQTVTHPTFLRSED
FT                   GGNALICTFEEGKGWVDESGNLKEPASERVRKHQYRPGQIAGHKEKPKKIKVKSAPETD
FT                   SAKTSSSRNAEVKETESTESTESTESEDWTSSSGSSSESDITDSESDDTASSSLPESGE
FT                   SGNFELSSSRNEQQQAATHVSSEEEPEGSAKSGVLPKGNSTEATSQQGSTEVHPLEALF
FT                   KKPADQQKLDTEPPVQFSFFGQGDADSDAGFEEELSSNVAPLTPFTKRDLLDRGLRSAA
FT                   PTPDTSQVSKIINWNTPKISSNAVGEDYSFTDSPMPKSGTAATEESDFSKWFWENRGDN
FT                   NRAWKKRRRDAAKEQRQRENRRKGMKGKS"
     atgacttccg aatcatctgc tacaacccgt ctacatatta cacctctgaa ccccgagctc        60
     atcccctcgg ttctgcctgc ctcggttcgt tcccttgcct cggacatatc cttccacggt       120
     atcccgacat ttcctgagaa caattacggc tacgtaacgc tgccgaaaat ggaggctgag       180
     aaactcaaga agaagctgaa tggctccatt cttaagggcc gcaagttcaa agttgaacct       240
     gctcgcccgc agaagcgaca ggcggaagag ggcgacgagc agaattttac gtcgaccgac       300
     aatccatccg taacagtgaa atccaagaag cgaaaggccg aagaaaatgt tttaagtggt       360
     tacgagctgc catcggaccg caaggtgaag cgagggtgga cagagtccac gactgataaa       420
     actgaacggc gaaaaaagga aaagagatcc aaagacaagc aggagaagaa agccaagacg       480
     cagctcaagt caaaatatac tgaaaaacca gaatgtttat ttcggacgaa agtgccgcca       540
     aacaagtctg cgctggcgga agagaaatcg aaaaagcaac caaagaagaa gaagacgtcg       600
     ccggagtctg tcgtgcatga gttcgcccaa acagtaactc atcccacgtt cttacgttca       660
     gaagatggtg gtaatgcgct catatgtacg ttcgaagagg gtaaaggctg ggttgacgaa       720
     tctgggaact tgaaggaacc cgctagcgag cgggtcagaa aacatcaata tagaccggga       780
     caaatcgctg gccataagga aaagccaaag aaaatcaagg tcaagtcagc tcctgaaact       840
     gactcagcga agacgtccag cagtcgcaac gcagaggtca aggaaacaga atccacagag       900
     tccacagaat ccacagaatc ggaagattgg acttcttcta gtggctcctc atcagaatca       960
     gacatcacgg actcggaaag cgatgatact gcctcttcca gtttacctga atccggggaa      1020
     tctggaaatt ttgagctatc ttcatcgaga aatgagcagc agcaagctgc gactcatgtc      1080
     agctctgagg aagagcccga ggggagtgca aaatccgggg tattgcccaa aggaaattcg      1140
     actgaagcaa cttcgcagca gggatcaaca gaagttcacc ctctagaagc tctctttaag      1200
     aaacctgccg accagcagaa actagatacg gagcctccag ttcagtttag tttctttggg      1260
     caaggagatg cagattcaga cgcaggtttc gaggaagagc tgtcatcaaa tgtagcaccc      1320
     cttactccat ttaccaaaag ggatctgctg gaccgtggac tacgaagtgc ggctcctaca      1380
     cctgacacat ctcaagtctc caaaatcatc aactggaata cccctaagat ttccagtaac      1440
     gccgtgggag aagattattc atttacagat agtccaatgc ccaagtcagg taccgctgcg      1500
     acagaagaat cagacttttc caaatggttc tgggaaaacc gaggggataa caatcgtgct      1560
     tggaagaagc ggaggcgaga tgcggctaag gaacagagac agagagaaaa ccgcaggaag      1620
     ggaatgaagg gaaaatcata g                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page