(data stored in ACNUC16935 zone)

EMBL: BN001307.PE248

BN001307.PE248       Location/Qualifiers
FT   CDS_pept        join(682460..682541,682613..682870,682946..683052,
FT                   683113..683166)
FT                   /locus_tag="ANIA_01422"
FT                   /old_locus_tag="AN1422.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008034"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008034"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008034"
FT                   /db_xref="GOA:Q5BDF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF8"
FT                   /protein_id="CBF84827.1"
FT                   /translation="MSRRNFIWHFLLLFIALLSFASSALASSPASFCKCTCFSNSTIIP
FT                   LDPDKGDSSLHGTLGLFSRNNYIDNQDEKRAGNYRSLSCNDCNRKFCLGYDLPTCKGAK
FT                   EDDVLTTCFQRDSRKDEAIVFIFIIATGGLLLWAVFRPWVQKWMEAARERRTYIPVSDS
FT                   PRL"
     atgtcacgac gaaacttcat atggcacttc ctgcttttgt tcatcgccct actttctttc        60
     gcatcttccg cactagcttc atcaccagca tcattctgca agtgcacgtg tttttctaat       120
     agcacgataa ttcctctcga ccctgacaag ggagactcgt ccttacatgg cacgctcggt       180
     ctcttcagtc gcaataacta catcgataat caggacgaga aaagggccgg taactaccgc       240
     tcgctaagct gtaacgattg caatcgaaag ttctgtttgg gttatgattt gcccacctgc       300
     aagggtgcga aggaggacga tgttcttacc acttgtttcc agcgagactc taggaaagat       360
     gaggcgatag tattcatttt catcattgcc accggtggtc ttctattatg ggcagttttt       420
     agaccatggg tgcaaaaatg gatggaggct gcacgggaac gacggacata tatcccggtt       480
     tctgacagtc ctcgactttg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page