(data stored in ACNUC16935 zone)

EMBL: BN001307.PE250

BN001307.PE250       Location/Qualifiers
FT   CDS_pept        686615..688777
FT                   /locus_tag="ANIA_01424"
FT                   /old_locus_tag="AN1424.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008036"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008036"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008036"
FT                   /db_xref="GOA:Q5BDF6"
FT                   /db_xref="InterPro:IPR024312"
FT                   /db_xref="InterPro:IPR039915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF6"
FT                   /protein_id="CBF84830.1"
FT                   /translation="MNLSIRQSFGYHNDDFKTRDDQIGEEDALSFNDLQSSPFRPDGRD
FT                   DTVDMQMLQKYQTSHDMSGLSTTPRKRSYDQAPDVHDLERDEIERHKRSVGRKDIPDIN
FT                   IYVDEDSRISYDQSAHDVTKQDMENSNMKEKQHEGMSTVLNEEHEDISSRDQNDFDDDA
FT                   SAVMVDDETHDLMDDTCLSTFSAVPNVDMTAFANLPGGSPFKTPRPLPEFPAENKDTRR
FT                   GSMEPATPVTAKRSPSKNILLDMSSPAGLPTPGKRQRDDPTPSETPNLLDLTDSIDLFP
FT                   RRQRYIMQQQGRYSPSRRSPLRNPRSPAKTSLLDFDIPAAPTPRSIPTVTPRELESLKS
FT                   GFLSEISSLKATLSGKEAEVSSLKKAVSDAERRVGEALEEVRIEAARKETLEIEQAEWQ
FT                   RRGREMEDVLRSVRADILEGEQERERLQKKNEEAERGKEQLQRRIVELETQLSAAQKSA
FT                   VCEHTTSETAAPSKTAEETAKEIQDAVEKVARDLHSLYKEKHETKVAALKKSYEARWEK
FT                   RLREAEKKLKAANDECEQLKAERDAALQESARPDASMISRENEQHEAAKHVFEAQIAGL
FT                   QQEITILKSNSEQLRAELKAERAEKGDLVALVEEWLSMQNQQPAPSPQAKSHEVTPEPV
FT                   PNEQLTPTEDAEREVTRSSSSGLRGPSSGSVSTSSHGEKKIPRFGAPAGRHVRGTSGGK
FT                   SGIAVFTPGRSGIMGSIERMGRGGAA"
     atgaacctaa gtatccgcca aagctttggc taccacaatg atgatttcaa gacacgggac        60
     gatcaaattg gtgaagagga tgctctatct ttcaatgatc tacagagctc gccttttcga       120
     cccgatggac gggatgatac agttgacatg caaatgctac aaaaatacca aacgtcccat       180
     gatatgagtg ggctctctac gactccgaga aagcgatcct acgaccaggc acctgatgtt       240
     catgatctcg aacgtgacga gatcgagagg cataagagat cagtaggcag aaaagacatt       300
     ccagacatca acatctatgt cgacgaggat tccagaatca gttatgacca gagcgcacat       360
     gatgtcacaa agcaagacat ggagaatagc aatatgaaag aaaagcaaca tgaaggcatg       420
     agcacagttc tcaacgaaga acacgaagat atctcttcca gggaccaaaa cgactttgat       480
     gatgacgcaa gcgccgttat ggttgacgat gaaacccatg atcttatgga cgacacctgt       540
     ctcagtacat tctcggcggt tccaaatgta gatatgacag ccttcgcaaa cttgccggga       600
     ggatctccgt tcaagacccc tcgacctctt cctgagtttc ctgctgagaa caaagatacc       660
     aggcgcggga gtatggaacc agctactccg gttacagcta aaaggtctcc cagcaaaaat       720
     atccttttag atatgagctc tcctgctggt ttgcccactc ctggaaagag acagcgagat       780
     gacccaaccc caagtgaaac acccaacttg cttgatctca cagatagcat cgaccttttt       840
     cctcgccgcc agcggtatat catgcagcaa caaggaagat actcgccatc gcgtcggtcg       900
     cctctgagga acccaaggtc acccgcaaag acgagtctac tggacttcga tatccctgcg       960
     gctcccacac ctcgatctat acccactgtc acccctcggg aattggagtc tctcaaatcc      1020
     ggctttctct cggaaatttc ttctttgaag gctacactta gtggaaagga agctgaagtt      1080
     tctagcctca agaaagccgt gtcagacgca gagcgtaggg tcggggaggc gttggaagaa      1140
     gttcgcattg aagctgctcg taaagagacc ctagaaatcg agcaggcgga gtggcagcgg      1200
     agaggccggg aaatggaaga cgtgctgcga tccgttagag ccgatatact tgaaggtgag      1260
     caggagcggg agcgcttgca gaaaaaaaat gaagaggcag agagaggcaa ggagcagctt      1320
     caacgccgta tagtagagct cgaaactcaa ctcagtgcag cccaaaagtc agcggtatgt      1380
     gagcacacga catctgaaac cgcggcgcca tcaaagacgg ccgaagagac tgcaaaagaa      1440
     atccaagatg cagttgagaa agttgctcgt gaccttcact cgctctataa agaaaagcat      1500
     gagacgaagg ttgcggctct caagaaaagc tacgaagcac gctgggagaa acgattgcga      1560
     gaagccgaga agaagctcaa agctgcaaat gacgaatgcg agcaactcaa agctgagcga      1620
     gatgcggcgc tgcaggagtc cgcacgccct gatgctagca tgatatctcg tgagaacgaa      1680
     caacatgaag cagcgaagca cgtcttcgag gcgcaaatcg cgggtcttca gcaagagata      1740
     accattctca agagcaacag cgaacagctg cgtgccgagc tcaaggcaga acgagcggag      1800
     aagggcgatc ttgttgctct tgtggaggag tggttgtcaa tgcagaatca acagcccgcc      1860
     ccatctccac aagccaaaag tcatgaggtg acgccggagc ctgttcccaa cgaacagctc      1920
     accccaactg aagatgccga acgcgaagtc actcgcagca gctccagtgg actccgcggg      1980
     ccgagttcag gttccgtttc tacttcgagt catggtgaaa agaagattcc aaggttcggc      2040
     gcaccggcgg gtcggcatgt acgaggaacc agcggcggca aatccggcat tgctgtcttt      2100
     acgcctggtc gaagcggcat aatgggctcg attgagcgga tgggccgtgg tggtgctgcc      2160
     tag                                                                    2163
//

If you have problems or comments...

PBIL Back to PBIL home page