(data stored in ACNUC16935 zone)

EMBL: BN001307.PE253

BN001307.PE253       Location/Qualifiers
FT   CDS_pept        complement(join(699220..699463,699517..699612,
FT                   699665..700278,700339..700911))
FT                   /locus_tag="ANIA_01427"
FT                   /old_locus_tag="AN1427.4"
FT                   /product="DUF895 domain membrane protein (AFU_orthologue;
FT                   AFUA_8G04110)"
FT                   /note="transcript_id=CADANIAT00008039"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008039"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008039"
FT                   /db_xref="GOA:Q5BDF3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF3"
FT                   /protein_id="CBF84836.1"
FT                   /translation="MATVNEKAAPLSTTDPEVQQDSQRLPGKPWMYKNLKLGPLTVPYY
FT                   ASPQFQLVLVAFVCFLCPGMYNSVNGLGGAGQLNHSDISKSNTATYSTFAVVGFFAGSI
FT                   ANRIGLRLTLSFGGFGYTLYVAALLCYNHTYNSGFLIFAGALLGLCAGLLWCAQGAVMM
FT                   AYPGENEKGKFISIFWVIFNLGGVIGGLIPLGQNIHNSDSAGSVNDGTYIAFMVLMVLG
FT                   FLLAWGLVDSKNIVRKDGTRVIAIKNPSWKSELLGLYETLLTDWYIVAFFPMFLASNWF
FT                   YSYHFNAINGSYFVPRAAALNSILYWAMQMIGAFCFGLILDLKSLKRPARAKLVWVLLF
FT                   TITMGVWGGGYAFQKTYTRETAGRSKDWNQSGYIGPMFLYMFYGFYDAAFQTCAYWFMG
FT                   CLSNNSRKLANFAGFYKGIQSAGAAITWALDFNETPYMNMFASCWGILCGSLLIASPII
FT                   FFKIKDHTDLEEDLKFSDETVADVTGIEVGDVTLRPQQQHTPEKRSPSDA"
     atggcaaccg tgaacgagaa agctgctccc ttgagcacca ccgatcctga ggtccagcag        60
     gactctcagc gtctccctgg caaaccgtgg atgtacaaga atctgaagct tggtccattg       120
     accgtgcctt actatgcttc gccacaattc cagttggtcc tggttgcttt cgtttgcttc       180
     ctctgcccgg gaatgtacaa ctccgtcaat ggtctgggtg gcgccggtca actcaaccac       240
     tccgatatca gtaaatccaa cacggccaca tacagcacct ttgccgttgt tggtttcttc       300
     gccggctcca ttgccaaccg cattggcctg cgattgactc tctcgttcgg tggttttggc       360
     tacacccttt atgtcgctgc tctcctttgc tacaaccata cctacaactc cggcttcctg       420
     atcttcgccg gtgccttgct tggtctatgc gccggtctgc tttggtgcgc tcagggcgct       480
     gtcatgatgg cttatccggg tgaaaatgag aagggcaaat ttatctccat tttctgggtt       540
     attttcaacc tgggaggtgt tattggagga ttgatccctc ttggacaaaa catacataat       600
     agtgattctg ctgggtcggt taatgatggc acttacatcg cttttatggt tctaatggtt       660
     ctcggcttcc ttctcgcctg gggtctcgtg gattccaaga atattgtgcg aaaggatggc       720
     acgcgcgtca tcgccatcaa aaacccatcc tggaagtcgg aactgcttgg cttatacgag       780
     actcttctga ccgactggta tatcgtcgct ttcttcccca tgttcttggc tagtaactgg       840
     ttctactcct atcacttcaa cgccattaac ggctcatact ttgtgccccg cgccgctgct       900
     ctcaacagta tcctatactg ggccatgcag atgattggcg ccttctgttt cggcttgatt       960
     ctggacttga aatccctgaa gagacccgct cgtgccaagc ttgtctgggt gctcctgttc      1020
     actatcacca tgggtgtctg gggtggtgga tatgccttcc agaagacata cactcgggag      1080
     actgcaggac gcagcaagga ctggaaccag agcggctaca ttgggcccat gttcttgtac      1140
     atgttctacg gtttctacga tgctgctttt cagacttgtg cctactggtt tatgggatgt      1200
     ctatcaaaca acagccgaaa attggccaac tttgccggtt tctacaaggg aattcagtct      1260
     gcaggtgcag ctataacatg ggcccttgac ttcaacgaaa cgccatacat gaacatgttc      1320
     gcttcttgct ggggtattct ctgtggctcc cttctaatcg cctcaccaat catcttcttc      1380
     aagatcaagg atcacaccga cctggaagaa gacctaaagt tctctgacga gactgtcgcg      1440
     gacgtcactg gcatcgaggt aggcgatgtc acactacgac cgcagcagca acatacccct      1500
     gaaaagcgga gtccctctga tgcctga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page