(data stored in ACNUC16935 zone)

EMBL: BN001307.PE257

BN001307.PE257       Location/Qualifiers
FT   CDS_pept        join(709782..710632,710664..710772)
FT                   /locus_tag="ANIA_01431"
FT                   /old_locus_tag="AN1431.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008043"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008043"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008043"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE9"
FT                   /protein_id="CBF84843.1"
FT                   /translation="MAILDKDRPRGLRVPSLSSFRSKHKSPESTPTIHLPSPSQMTLQN
FT                   ESIPVSSFKPAEKALPPQPLPSAPQPSSAAGYPYPYPPQTYNNPPTPVSVQNSTPTRPF
FT                   GHDGPAQPPLPALPADRPMPRPIPQSTTPPARRPIPRSTAASTTAPAPAPAPEPAPEPA
FT                   PEPVPAQTSTPVYAPAPIPAPSSVPPVNNLIAQQRTPPLSEGGPEQRKSNGTSDSLEDL
FT                   IPSPEPEPELDGASSTPNETGSSEEDNRPFTPPEVEPVAVPLTKLHYACYQDHRAMPAT
FT                   GNVNSIVRSVTDAFFAACVFAPIVIKRCKNALAVRWHS"
     atggccattc tggacaagga ccgcccccgc ggcttgcgag tgccgtcgct ttcctcgttc        60
     agatccaaac acaagtcgcc tgaatcaaca cctactatcc acctgccttc accttcgcaa       120
     atgacccttc aaaacgagtc aatcccggtg tcttctttca aaccagccga aaaggcattg       180
     ccccctcaac cgctgccgtc cgcgccacag ccctcatccg cggcgggata cccataccca       240
     tacccgccgc aaacatacaa caatccacca actccggtat ctgtccagaa ttcgacccca       300
     actcgacctt tcggccatga tggtcctgcg cagcctcctc tacctgcgct ccccgccgac       360
     agacctatgc cccggccaat ccctcagtct actaccccac cagcccggcg cccgattccc       420
     aggtccacgg cggcttcaac aactgcgcca gcgccagcgc cagcaccaga accagcacca       480
     gaaccagcac cagaaccagt accagcacaa acatcaacac cggtatatgc acctgcgcct       540
     attcctgcgc cttcatctgt accaccagtg aacaatctca ttgcgcaaca gagaaccccg       600
     ccactgagcg agggggggcc ggagcagagg aaatccaacg gcaccagcga ctctttggaa       660
     gacctcatcc cgtcgcccga accagagcct gagctagacg gtgcgagcag cacacccaat       720
     gaaaccgggt ccagcgaaga ggacaacaga cccttcacac caccggaggt tgaacccgtt       780
     gctgtcccgc tgaccaaact gcattacgcc tgctaccagg atcatcgcgc aatgccggcc       840
     accgggaacg taaattcgat cgtgagatcc gtcaccgatg cgttttttgc tgcctgcgtg       900
     tttgcgccga ttgttatcaa gcgctgcaaa aatgccctcg ccgttcgctg gcacagctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page