(data stored in ACNUC16935 zone)

EMBL: BN001307.PE258

BN001307.PE258       Location/Qualifiers
FT   CDS_pept        complement(join(711140..712102,712173..712274))
FT                   /locus_tag="ANIA_01432"
FT                   /old_locus_tag="AN1432.4"
FT                   /product="G-patch domain protein, putative (AFU_orthologue;
FT                   AFUA_8G04200)"
FT                   /note="transcript_id=CADANIAT00008044"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008044"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008044"
FT                   /db_xref="GOA:Q5BDE8"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR025239"
FT                   /db_xref="InterPro:IPR039249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE8"
FT                   /protein_id="CBF84845.1"
FT                   /translation="MAAEEDEVDYMSMVIEEPQQKETFTQKKRRLQREAEARARVPSKA
FT                   ERAAQEAAKRDAALATSTLNPSNKGFQMMAKLGFKPGQTLGKPAGEDREKEGSGPNAQS
FT                   RTEPLNLIFKEDRGGIGLDSERKRKIREEAEEAAKKIKAEEGDYRDRVRLERETKRIEA
FT                   QIHAAQKVAERLDADENGEADLFSASNVEDKDKNEEKDEKEQEGSDEEAPATKPKAKAK
FT                   VKPTSQINILYRGLVREREEKERAIQTRHMLQTSLPTSFFPNPRLPGYEDATLDRDDHE
FT                   ALGGGRDLSTVLEQEVEEEDPELDEFNTLEPAERLRRLVEYLREKHNYCFWCKYRYDTA
FT                   EMEGCPGVTEEDHD"
     atggctgcgg aggaggacga ggttgactac atgtccatgg tcatagagga accacagcag        60
     aaggagactt tcacgcaaaa gaagcgccgg ctccaacgag aggccgaagc ccgcgctaga       120
     gttccgtcga aagccgaacg tgccgcccag gaagctgcca aacgcgatgc agccttggca       180
     actagtacac ttaacccctc taacaagggg tttcagatga tggcaaagct gggatttaaa       240
     ccaggccaga cgctgggaaa gcctgccgga gaggatagag agaaagaggg tagcggtcct       300
     aatgcacagt cgcgcacgga acctttgaat cttatattta aggaagaccg tggtgggatc       360
     gggctggata gtgagcggaa gcgcaagatt cgggaggagg ccgaggaggc cgcgaaaaag       420
     atcaaagccg aagagggcga ctatcgagat cgtgtacgac tcgagcgcga aacgaagcgc       480
     atcgaagccc agattcatgc agcgcagaag gtcgcagagc gattagatgc ggatgaaaac       540
     ggggaagcgg atctcttttc tgccagtaac gtcgaagata aggataagaa tgaggaaaag       600
     gacgagaagg agcaagaggg cagtgatgaa gaagctcccg caactaagcc caaagcaaag       660
     gccaaggtaa agccaacgtc tcaaatcaac atcctatacc gcggacttgt gcgcgagcgt       720
     gaagaaaagg agcgcgccat tcagacccgg catatgctgc agacatcctt gccgacatcg       780
     tttttcccga acccgcggtt accgggttat gaagacgcga cgttggatcg ggacgaccac       840
     gaagcccttg gcggcggacg tgatctctct accgtcctcg agcaagaagt agaggaagaa       900
     gacccggagc tggacgaatt caataccctt gagccggctg agcgcttacg gcggttggtt       960
     gagtatctcc gcgaaaagca caactattgc ttctggtgca aatatcgcta cgatactgcc      1020
     gagatggagg gatgtcccgg tgtgacggag gaagaccatg attga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page