(data stored in ACNUC16935 zone)

EMBL: BN001307.PE26

BN001307.PE26        Location/Qualifiers
FT   CDS_pept        complement(join(70747..71147,71209..71276,71323..71830,
FT                   71883..71919,71962..72153))
FT                   /locus_tag="ANIA_09036"
FT                   /old_locus_tag="AN9036.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007817"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007817"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007817"
FT                   /db_xref="GOA:Q5ARP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP4"
FT                   /protein_id="CBF84417.1"
FT                   /translation="MGVTSTVCEIPPRNRKSTQLAVGWIFIVLTTLALGLRLMARPPLS
FT                   ASFGIDDGIGIGTYVQLLSCTALVDMILMIQGANLGWGTDMWALQAEQIILQMKVDANL
FT                   QPIFILFTNNSTLCQLFYAGIIAFYLSVSLAKLSILFFYLRIFTTDTFKRIAYTMIFLC
FT                   SAYGVGSVVTSILDCMPPSYFWTRFDGVSTGYCVSKAAFKVIPPVNIALDVVVMVLPLP
FT                   LLARLNLPLQKKIRVLSMFSMGVLIIVADILRITHLFHSITAYNITYNGGELSYFGVIE
FT                   SGVGVICICMPAIAALLKRVLPQCFGSLAKRSYLYRTINSRSNTEFGASRSRSQRGAIQ
FT                   PSAYAHTNPNNPVSFSAIAWGAREDERDGDGNTSDIHLTLLPATEIADERIQRPQKALT
FT                   SR"
     atgggtgtga caagcactgt ctgcgaaata cccccacgga accgcaaatc cacccagctg        60
     gccgtcggat ggatcttcat tgtcttgacg actttagccc tgggtctcag actcatggca       120
     cgaccgccgc tgtctgcttc atttggtatt gatgatggga ttggaattgg tacatatgtg       180
     cagttgctct cgtgcacggc gttggtggac atgatcctta tgatccaggg agcaaaccta       240
     ggctggggaa cagacatgtg ggcgctccag gctgaacaaa ttatcctgca gatgaaggta       300
     gatgctaacc tccaacccat ctttatcctc ttcactaaca acagtaccct ttgccagctc       360
     ttctacgccg gcatcatagc cttctatctc tctgtctccc tcgcaaaact ctccatcctc       420
     ttcttctacc tccgcatctt cacaacagac acattcaagc gcatcgcata cacaatgatc       480
     ttcttgtgct ctgcttatgg agtcgggtcc gtggtgacca gtatactcga ctgcatgccg       540
     ccgtcgtatt tctggactcg gtttgatggc gtttcgaccg ggtactgtgt cagtaaggca       600
     gccttcaagg tcatacctcc tgtcaatatc gcactcgatg tggtggttat ggttctgccg       660
     ttgccattgc tggcgagact gaatttgccc ctgcagaaga agatcagggt gctaagtatg       720
     ttctcgatgg gcgtgctgat tatcgttgca gatatcctcc gaatcacaca cctctttcac       780
     tctatcacgg cgtacaatat cacctacaat ggcggcgagc tctcctactt cggtgtcatt       840
     gagtccggtg tgggcgtcat ctgcatctgc atgccagcta tcgcagcact cttgaagagg       900
     gttctaccgc agtgctttgg ctcgttggca aaacggtcgt atctgtatcg caccattaac       960
     agtcgcagta atactgagtt tggcgcgtcc cgttcgcgct cgcagcgggg cgcaatacag      1020
     ccgagtgcat atgcacatac gaaccccaat aatccggttt ccttctcagc cattgcttgg      1080
     ggcgccaggg aagatgagag ggatggagat ggaaatacga gtgatataca cctgacgctg      1140
     ttaccggcca ctgaaattgc agacgagagg atacagaggc cgcagaaggc tttgacttct      1200
     agataa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page