(data stored in ACNUC16935 zone)

EMBL: BN001307.PE260

BN001307.PE260       Location/Qualifiers
FT   CDS_pept        complement(join(715168..717621,717674..717961))
FT                   /locus_tag="ANIA_01434"
FT                   /old_locus_tag="AN1434.4"
FT                   /product="rRNA maturation protein (Nop14), putative
FT                   (AFU_orthologue; AFUA_8G04220)"
FT                   /note="transcript_id=CADANIAT00008046"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008046"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008046"
FT                   /db_xref="GOA:Q5BDE6"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE6"
FT                   /protein_id="CBF84849.1"
FT                   /translation="MPPSQLKQLKASLRDTGLLGPQKSKKQKRQNAKTGANAQNRAQRE
FT                   SALNAIRERFNPFEIRTVSRGKFDVTTRDGGAKSASGNFRPGVTKSLGEERRRQTLLQE
FT                   MDRRNKVGGIMDRRFGENDPTMTPEERAAERFARASQKKLRKDSMFNLEEDDEEEFTLT
FT                   HKGESLSFGDEDGIRDDFQEDLDAGDMSDTEMPRKRKRFIDDPEAEEDGSQDGEDVPER
FT                   KKSKHEVMQEVIAKSKFYKAQRQMAKEDDDELREELDKGLPELFDMLRGVKPPPKQEPP
FT                   KDDLAGMNPDRAAIMQGHSQGDPEKEYDQRLKQLTFDKRSMPTDRTKTEEEKAEEEAQR
FT                   LKKLEEERIRRMRGEDVSEDEAEAAEEEEDGEESEEESLPDDAKDFGLQQPTNYSTSRP
FT                   EGVDDEDDFILDDLVETRSDVSLSFVEDDEDIIGSEEESEDEEEEDELINGITMPGEES
FT                   GNEAPAPDTQIAGDGLAYTYPCPNSHEEFLKTIKDISYEDLPTVIQRIRALHHPRLHSD
FT                   NKVKLGRFAGILVQHAAYMVEQPQRPPFAVVENVLRHIHSLAKSHPESVSLAFRAQLRE
FT                   VAADRPLSLRPGDLVILTGIATIFPTSDHFHAVSTPAHLCLARYLGQGPVNSLSDLCTG
FT                   TYAASLALQYQTISKRYMPEFLNYVLNALCILSPGEPSSKLGSFPLRQPTELLRIRPSK
FT                   PLNIRKLQFLDVSARSEIDPEDLKLSLITTLSSLLNTASDLWSSKSASVEIFNQAQAVL
FT                   QHVSSSCVDVNKKAKKAKNPLIPAAALDTLQSTLDKLSTVLSQSRLTRRPLLLHNHRPL
FT                   AVKTAIPKFEDSFNPDKHYDPNRERAEVNRLKAEYKRERKGAMRELRKDANFIAREKLR
FT                   EKKEKDAEYERKYKRLVAEVQNEEGREANAYEREKRMRQGKR"
     atgccgccgt cgcagctcaa gcagctgaaa gcttctcttc gcgatactgg attactgggt        60
     ccccagaagt ccaagaagca gaagcgtcaa aatgcgaaga ccggtgcgaa tgcgcaaaac       120
     cgggcccaac gcgagtccgc cctaaacgct attcgagaac gattcaatcc ctttgagatt       180
     agaacggttt cccgcggcaa gttcgatgtg actacacgag atggcggcgc caagtcagct       240
     tcagggaact ttcgaccggg agtcaccaag tctcttggtg aagagaggag acgtcaaacc       300
     ctattgcagg agatggatcg caggaataaa gtcggaggta ttatggatcg gcgttttggt       360
     gagaacgacc cgaccatgac accggaagaa cgagccgcgg aacgattcgc cagagccagc       420
     caaaagaaac tacgcaaaga ctcgatgttc aatcttgagg aggatgatga agaggagttt       480
     acgcttacgc acaagggtga atcgctatcg ttcggtgatg aggatggcat tcgcgatgat       540
     ttccaggaag atttagacgc aggcgacatg tcagatactg aaatgcctcg aaagagaaaa       600
     cgattcattg acgatcccga agccgaggag gacggatcgc aagatgggga agatgtcccg       660
     gaacgaaaga aatcgaagca cgaagtcatg caggaggtca tcgccaaatc caagttttac       720
     aaagcgcagc gacaaatggc gaaggaggac gatgatgaat tacgtgagga gctggataag       780
     ggtctacctg aactctttga tatgctccga ggagtgaaac cccctccaaa acaagaaccg       840
     ccaaaggacg atcttgcagg aatgaatccc gatcgcgcag ccatcatgca aggccactct       900
     cagggagacc cagaaaagga gtacgatcag cgattgaagc aactgacttt cgacaagcga       960
     tcgatgccta cggaccgtac taagacagag gaagagaagg cggaagaaga ggcacaacgg      1020
     ttgaagaaac tcgaggaaga acggattcgc agaatgcgtg gtgaagacgt tagcgaggac      1080
     gaagcagagg cggccgaaga ggaagaggac ggcgaagagt ctgaggagga atctctcccg      1140
     gatgatgcaa aagatttcgg gttgcagcag cctacaaatt actccacatc tcggccagag      1200
     ggtgttgacg atgaagacga ttttatcctt gacgacctcg tagaaacgag gtcggacgtc      1260
     agcttatcgt ttgtcgaaga cgacgaggat attattggtt ctgaagaaga gtctgaggat      1320
     gaggaagagg aagacgagct cattaacggc atcaccatgc caggcgagga gtctggcaat      1380
     gaagcaccag ctcctgatac acagattgcc ggcgatgggc ttgcatatac atacccgtgt      1440
     ccaaacagcc atgaggagtt tcttaaaaca atcaaggaca tctcttatga agacctgcca      1500
     accgttatcc agcggatccg agctctgcac cacccccgcc ttcacagtga caacaaggtc      1560
     aagcttggcc gattcgccgg tatcctcgtt cagcacgccg catacatggt tgaacagcca      1620
     caacgcccgc cctttgccgt cgtggaaaac gtactgcgtc acatccactc tttagccaag      1680
     agccatcccg agagtgtatc actggcattc agggcccagc tgcgcgaagt cgcagcagac      1740
     cgtccgctca gcctccgacc tggtgacctt gtcatcctca ctggaatcgc cactatcttc      1800
     ccaacctcgg accacttcca cgctgtatct acaccagcgc atctctgcct tgctcggtat      1860
     ctcggacaag ggcccgtcaa ctcgctgtct gacttgtgca cgggcaccta cgctgccagt      1920
     ctagccttgc agtaccagac tatctctaag cgctacatgc ccgagtttct gaactacgtc      1980
     cttaacgcgc tgtgtattct cagtcctgga gagccttcct ctaagctcgg atccttccct      2040
     ctccgccaac cgacagaact cctacgtatc agaccttcaa aacctctaaa catccgcaaa      2100
     ctccagtttt tggacgtatc cgcacgatca gaaatagatc cagaggacct taaactctcc      2160
     ctcatcacaa ccctttcctc cctcctcaat acagcatccg atctctggtc cagcaagtcc      2220
     gcctcagttg agatcttcaa ccaagcacag gctgtccttc aacacgtctc gagttcctgc      2280
     gtcgacgtca acaagaaagc aaagaaggca aagaatccct tgatccctgc cgccgctctg      2340
     gacacgctcc aatccaccct cgacaagctc tccactgtcc tctctcaatc tcgcctcaca      2400
     cgccggccac tcctcttgca caaccacaga ccacttgctg tcaaaacggc gattccgaag      2460
     ttcgaggact cgttcaaccc tgacaagcac tacgacccca accgtgagcg ggctgaggtt      2520
     aaccggctca aggcggagta caagcgtgag cgcaagggtg ctatgcgcga gctccgcaag      2580
     gacgcaaact tcattgccag ggagaagttg cgggagaaga aggagaagga cgctgaatat      2640
     gagcgaaagt ataagaggct tgttgcagag gtgcagaatg aggaggggag agaggcaaat      2700
     gcttatgaga gggagaagag gatgcggcag gggaagaggt ag                         2742
//

If you have problems or comments...

PBIL Back to PBIL home page