(data stored in ACNUC16935 zone)

EMBL: BN001307.PE262

BN001307.PE262       Location/Qualifiers
FT   CDS_pept        complement(join(719464..720442,720492..720604))
FT                   /locus_tag="ANIA_01435"
FT                   /old_locus_tag="AN1435.4"
FT                   /product="origin recognition complex subunit 3, putative
FT                   (AFU_orthologue; AFUA_8G04240)"
FT                   /note="transcript_id=CADANIAT00008048"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008048"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008048"
FT                   /db_xref="GOA:Q5BDE5"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="InterPro:IPR040855"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE5"
FT                   /protein_id="CBF84853.1"
FT                   /translation="MSHFFANPISVLLADRVGEDLQNDKLCEAIRNVPSFREYCEILLE
FT                   DSKTQQVRDLLEDDKLLLLETTRLIRAGQRSMHYMFQAVKFISILLKELNISKKVSISE
FT                   LSIRALCGELQKSPLLEDVLAAFRRLDSSRVAGLLSQFPEALRSLPDLRGVEADFRSLT
FT                   KAHEGPEPLRSEYDSQNSVIGTTIVKQRVKLDTGKAKLPEETIKYTRIINRCCTLLRSY
FT                   FVNILVFPQELPLHEAFLLDMRNPIKEVFAPRARYAIERALSNPFDYLLFTSQDTERKI
FT                   SAKQPPTAILYQLYLESGALVNMYDLWTAFYAVFESEQGDSCDERMTMALFYRALSELR
FT                   ALGMLKHSRKKLDHVAKSAWKGL"
     atgtcccatt tcttcgccaa cccaatttcg gtactactgg cggaccgcgt tggggaagac        60
     ctacagaatg ataaactatg cgaagccatc cgaaatgtac cgtcctttag ggagtattgt       120
     gagattttgt tggaagatag caagacacaa caagtgcgag acttgttgga ggatgacaaa       180
     ctccttctct tggaaaccac ccggctcatc agagctgggc aacgatcaat gcattacatg       240
     ttccaggcgg tgaaatttat ctctatattg ctcaaggaac tcaacatctc caagaaagtg       300
     agcatatcag aattgtctat tcgcgcattg tgcggggagc tgcaaaaatc tcccctactc       360
     gaagacgtcc tcgccgcctt tcgacgattg gattctagca gagtcgcagg gttgctctcc       420
     cagttccccg aagctctaag aagccttcct gatttgcgcg gtgttgaggc ggacttcaga       480
     tctttgacaa aagcccacga aggaccagag cctctgcgta gtgagtacga cagtcaaaat       540
     tccgttatcg ggaccaccat agtgaagcaa cgtgtcaaac tcgacacggg caaagcgaag       600
     ttgccagaag agactataaa gtacacaagg attataaacc gttgttgtac attgctaaga       660
     tcatattttg tgaacatcct cgtcttcccg caagaattac ccttacatga ggcattcctg       720
     ctcgacatgc gaaatcccat taaagaagtc tttgcaccgc gagcccgata tgcaatagag       780
     cgagcattat cgaacccgtt tgactatctt ctgtttactt cacaggacac cgaacgcaag       840
     atttccgcca agcagcctcc cacggcgatc ttatatcagt tatacctcga gtccggcgct       900
     ctcgtgaata tgtatgacct gtggacagca ttttacgcag tttttgagag cgaacagggt       960
     gatagctgcg acgagaggat gactatggca ttattttaca gagctttatc tgagctcagg      1020
     gcactcggga tgctcaaaca tagtcggaaa aagttggatc atgttgcaaa gtcagcttgg      1080
     aaaggcttat ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page