(data stored in ACNUC16935 zone)

EMBL: BN001307.PE263

BN001307.PE263       Location/Qualifiers
FT   CDS_pept        722166..724751
FT                   /locus_tag="ANIA_01436"
FT                   /old_locus_tag="AN1436.4"
FT                   /product="pentatricopeptide repeat protein (AFU_orthologue;
FT                   AFUA_8G04250)"
FT                   /note="transcript_id=CADANIAT00008049"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008049"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008049"
FT                   /db_xref="GOA:Q5BDE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE4"
FT                   /protein_id="CBF84855.1"
FT                   /translation="MLRPVIRGARWYQHVARSSSSAASPRSFTRAFTAAAPRLIDYGGP
FT                   NDKIKFYEQDTRRSTKRRRIDPEAEDIAEKEEVARELSQLDHELESLKEDPFGPNSSFI
FT                   QSLPEDERAIALEALRKQEARDGKDEPITFDDVFDEELDNLLKEEFEGLALEEENWMKK
FT                   KDDSLQEVIRQPYEMAFGDSEHSDYIDRFNRALKRFAADKSSEKARQDLWNWYRGCKQI
FT                   IPHFVSAIPEEAMTLLWSSQTSVGQHAARIQVLAEDALLAGRSLPTAHVLSYISSLQQL
FT                   GKTREALDQWEMHQDGLSQQKEDLEAYWKLGVQLFTAEGNPQRAQDIALAFMKNDNFQH
FT                   ARILIPIIIAWGRQSGKEADSKLWALYLQLKAMLRHKMTMDDYDQISIGLLKAGKLDLA
FT                   IAVFKDMMVTGKDSANDSTALYTAALGLAGNLQASAVSEQDVNKVSLSTLTVLPRRFEN
FT                   RFFYASWLKKLIGMGEVDSAALVVELMYERGVRPDPKHLNGLIAGWLREGSAPAREKAE
FT                   ELGWSMIKQRIDRVSKAEAKDSEQPETGRTNARIPKFMQRPMPAATIETFSILLLHYTR
FT                   RGDQEAVEHLVKNLTLSRIQPNSYFMNHLLYAELRKQDIGALWNKFQVLSSSVQPDLET
FT                   YACLWDCGKLQYDRSRTAYFAEFPTARALYSNMMTWFSYLSTRAQTTAREDFSKDLYDQ
FT                   IIRCFCLSKDLAGTLVALCSLHSTFGFHPDETTARLIILQVARLAAVPSDTPKRRLRRI
FT                   SSTPHSKANIAQVQQLVEILSDRKSATLESRGLTISSLDPHEKEMHQLEIMTDLLRIVM
FT                   SRADTSPNQTPDPNRVEEQLCTVAEEMGVPGIYLGPRLDDENAGLVSMR"
     atgctccgcc cggtgattcg aggagctcgg tggtatcaac atgtggcccg ctcgagcagt        60
     tcggcggctt cgcctcgttc ctttactcga gcattcactg ctgcagcgcc gcgattaatc       120
     gattacggtg ggcccaatga caagataaaa ttctacgaac aagatacccg ccgaagcacg       180
     aagaggagga ggatagatcc ggaagcggaa gatattgcgg agaaggaaga agtggcgcgc       240
     gaactttcgc agctggatca tgaactagag tctctgaagg aggacccgtt tgggcctaac       300
     agcagcttca tacagagcct accagaagat gagagggcta ttgcactgga agctctgcga       360
     aaacaggagg ccagagatgg caaagatgaa cctatcacct tcgatgacgt ctttgacgaa       420
     gagcttgata acctgcttaa agaagaattt gagggcctag ccttggagga agagaattgg       480
     atgaagaaaa aagacgacag tttgcaggaa gttatacgac aaccatacga aatggcattc       540
     ggggactcag agcacagcga ctacattgac agattcaatc gtgctttgaa gcggtttgct       600
     gccgataaat ccagcgagaa agcaaggcaa gacctttgga attggtaccg aggatgcaaa       660
     cagatcattc cacattttgt cagtgcgata cccgaggagg ctatgacgct gctctggtct       720
     tcccagacct cagtagggca acacgcagct cgtatacaag tccttgctga agacgcctta       780
     ttagccggtc gatctcttcc tacggcgcat gtgctttcat atataagttc tctacagcaa       840
     ctgggtaaga ccagagaagc actcgaccag tgggagatgc accaggatgg gctcagtcag       900
     cagaaagaag acctagaagc ctactggaag cttggggtac agctcttcac tgctgaaggc       960
     aatccacagc gagcccagga tattgctcta gcatttatga agaacgacaa ctttcagcac      1020
     gcccgcatcc ttatacccat tatcatcgct tggggaagac agtctgggaa ggaagcagat      1080
     tctaaactgt gggccctcta ccttcaatta aaagcgatgc ttcgacataa gatgaccatg      1140
     gatgactatg atcagattag tattggactt ctcaaagccg ggaagcttga cctcgccatc      1200
     gctgtattca aggacatgat ggtgacaggc aaggattcgg caaacgattc aacggctctg      1260
     tacactgcag ccctcggact ggctgggaac ctgcaggcct cagctgtttc cgaacaggat      1320
     gttaacaaag tttccctttc cacgctcacg gtcctacccc gtcggttcga aaatcggttt      1380
     ttctacgcca gctggttgaa aaaactgatt ggaatgggtg aagtcgattc cgccgctttg      1440
     gtagtcgagc tgatgtatga acgcggtgtg aggccagatc caaagcatct taatggtctg      1500
     attgccggct ggctacgcga gggaagcgcg cctgctcgag agaaagcgga agagctaggc      1560
     tggtccatga tcaaacagcg gatcgaccga gtctccaaag ccgaagcaaa ggattcagag      1620
     caaccagaaa ctggacgcac gaatgctcga attccaaaat tcatgcaacg accaatgcct      1680
     gcagcgacca ttgaaacatt ttcgattcta ctccttcatt ataccaggcg aggcgatcaa      1740
     gaagcagtcg aacatcttgt caagaatctc acgctttccc gtattcaacc taactcttac      1800
     ttcatgaacc atctcctcta cgctgaactt cgaaaacagg acattggtgc cctctggaac      1860
     aaatttcaag tactatcatc ttccgtgcag ccagaccttg aaacatatgc ttgcctctgg      1920
     gactgcggca aacttcaata cgaccgcagc cgcacagcat acttcgccga gtttccaaca      1980
     gcccgcgcgc tctactcaaa catgatgacc tggttctctt atctttccac ccgagcccag      2040
     acaaccgccc gggaagactt ttccaaagac ctttacgacc aaatcatccg ctgcttctgc      2100
     ctctccaaag acctcgcagg tacacttgtc gccctatgct ccctgcactc aaccttcggc      2160
     ttccacccgg acgaaacaac agcccgtcta atcatcctgc aagtcgcacg tctcgccgcc      2220
     gtcccatcgg atacccctaa acgccgtctc cgccgcatct cctcaacccc gcatagcaaa      2280
     gcgaatatcg cgcaggttca gcagcttgtt gagatcctca gtgatcgcaa atccgccaca      2340
     cttgaatcga gggggcttac catcagctcg ctagatccgc atgagaaaga gatgcatcag      2400
     cttgagatca tgactgatct gctgcgcatc gtcatgagcc gggccgatac tagtcctaat      2460
     caaacacctg atcccaaccg tgtagaagag cagctttgca ctgttgcgga ggagatgggt      2520
     gtgcctggga tttatcttgg gccgagattg gatgacgaga acgctggctt ggtatcaatg      2580
     agataa                                                                 2586
//

If you have problems or comments...

PBIL Back to PBIL home page