(data stored in ACNUC16935 zone)

EMBL: BN001307.PE264

BN001307.PE264       Location/Qualifiers
FT   CDS_pept        726129..729671
FT                   /locus_tag="ANIA_01437"
FT                   /old_locus_tag="AN1437.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G04300)"
FT                   /note="transcript_id=CADANIAT00008050"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008050"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008050"
FT                   /db_xref="GOA:Q5BDE3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE3"
FT                   /protein_id="CBF84857.1"
FT                   /translation="MSAVSPQFVQSDSNDRNLDPELSNPFLTENDPEEAEFQKFTIRLT
FT                   PVDDRGSAWTGSTSSQDHSINNTSTTGNHEGYGTTYSEFLSPVDEWASDISGHTSPADL
FT                   MIPGVWPVIATSPQNVTASSPTQSGPSPSSPPASINPSQLLTPVLTNHPSPASDTRSVG
FT                   SPRIPRAQQPPVPRLKTTLLDDNLGPGPVSESVTTISPIVKVESYSRGDSPVRDSFSTN
FT                   RRPSQSSIHLSPGGASNASGEDATIEDDRHSVSRSADGAWVPNVLTGQAGLAPDAREDV
FT                   YVPSPNELDSQRKLAERNADIYTWSEAVSEAHSEAGDDYLCFQRGRTDYHGTRRRAKST
FT                   GDPSLDYFSLKFTPDRSEIRGPGLVLHETSDYSDDETESSAPVSVKEERLVQEAFEMTP
FT                   PEPQSAETGEPQAHQFLGSPPWRDIELDRSPQTTRMQPVSSTQAMVEYQRRARETDAIS
FT                   RVATWGTRDLDANSIRSFQMMSLNENGKEKKHERRNSFLKYLPQKKGNLLKRQRQKTDL
FT                   STMQPVHEGEAQDTESKAAPQRKDSFPHRLSLPFTPKTTNYSISGAVMATTRQMAAIGG
FT                   KDSLSVVSPSTTTTTTTKPWNTLKVRGRSRSEVPRAPGLFELMTTHGGPPVPNISYTSE
FT                   PVENKEAKHARPQHDAAEEDDDDDSEEKLIMEFPIPKELPIPTLEGFKTQILRLNPRIE
FT                   PALIDRFAHEQVRRYKRLIEIKQTHARDVNHRKCKAGKFCFALGGTAKLLPPRLSAQDG
FT                   DSHTQFQIPRPGEEEESSEDLGETTMLAHFPQGVPHPPPQVKLLPAEFECMVCYHVKKF
FT                   QKPSDWTKHIYEDVQPFTCTFPDCTDPKSFKRKADWVRHESERHRQLEWWECSLADCRH
FT                   KCYRKDNFVQHLVREHKMPEPKVKKPRNRELSDGASNDPTSLEVQEEINREREINGLWK
FT                   LVESCHFETARNPREEPCRFCGNVCTNWKKLTVHLAKHMEQLAIPILGLVKERDFPYTV
FT                   NIGSSGNPDNFSGQVPIAQKDSDFDPRLDTGVTEGPGTADNFTQAPYSNSHPGSSEPIM
FT                   LPFNTGASYLPNASMPLDSTAPNPAARFEGVTPYTAHGGGVAGLAGDQTRLMAMHQHQN
FT                   SVTYPPFNARPRLTVPNQDMRVLPEYNSFSMSPTEMQYDPQTTAYVSSGAENHYPYQGP
FT                   IASAMPYDSGYQGQ"
     atgtcggctg tctcgcctca gtttgtccag agcgactcga acgatagaaa tctcgacccc        60
     gaactctcaa acccctttct tactgaaaat gaccctgaag aggcggagtt ccaaaaattt       120
     acaataagat tgacgcctgt cgacgaccga gggagcgcat ggactggatc tacgtcctcg       180
     caggatcact ccatcaataa cacgtccaca acaggcaatc atgagggcta cggtaccacc       240
     tactctgaat tcctcagccc agtggacgag tgggccagtg atataagcgg ccatacatca       300
     cctgcagatc tcatgattcc aggcgtttgg ccagtcattg ctacatcacc tcagaacgta       360
     acggcgagct caccaactca atctggtccc agtccgtcgt ctccgcccgc gagcataaac       420
     ccttcccagc tccttacgcc agttcttacc aatcatccaa gcccagcgtc ggatacgagg       480
     agcgttggga gccctcggat tccgcgggct cagcagcctc ccgtacctcg tttgaaaaca       540
     acgctcttag atgacaatct cggccctggt ccagtttccg agtcggtcac aacgatcagc       600
     ccaattgtca aagtggagag ctattcacga ggcgattcgc ccgtcaggga cagcttctca       660
     acaaaccgcc gcccaagtca atcctccata catttgtccc cggggggcgc gtccaacgct       720
     tcgggtgaag atgctaccat agaggatgat cgtcattccg tttcaaggtc agccgatggg       780
     gcatgggtcc caaatgtgct gactggccaa gccggcctcg caccggatgc gcgagaggat       840
     gtatatgttc ccagccccaa tgaactcgac tcacagcgaa aactagcgga aaggaatgcc       900
     gatatctata catggtcaga ggccgttagt gaggcccaca gtgaagctgg tgatgattat       960
     ctgtgtttcc agagagggcg aacagattac catggcacta ggcggagggc gaaaagtacc      1020
     ggtgatcctt cactcgatta tttcagtcta aagttcaccc ctgaccgatc tgagatccgt      1080
     gggccgggtc ttgtgctcca tgagacaagc gattatagcg acgatgaaac agagtcatct      1140
     gctcctgtta gtgtaaagga agagagattg gtccaggaag catttgaaat gacgccccct      1200
     gaacctcagt ctgcagaaac gggtgagccg caagctcatc agtttctcgg gtctcctccg      1260
     tggcgtgaca ttgagctcga ccggtctccc caaacaacac ggatgcagcc ggtcagctcc      1320
     actcaagcta tggttgaata ccaaagacgt gctagagaga ctgacgctat atcccgcgtt      1380
     gcaacgtggg gcacgcgcga tcttgatgcc aacagtatca gatccttcca gatgatgagc      1440
     ctcaacgaaa atgggaaaga aaagaagcac gagagacgta acagttttct caagtatctt      1500
     ccccaaaaaa aaggcaatct cctgaaacgt caacgccaaa agactgatct ttctaccatg      1560
     cagcctgtcc acgaaggcga agcccaggac acggagagca aggctgctcc ccagaggaaa      1620
     gacagcttcc cgcaccgatt aagtctcccc tttactccaa aaactaccaa ctatagtatt      1680
     agtggtgcgg ttatggcaac aacgaggcag atggctgcca ttggcggcaa agattcgcta      1740
     agtgttgtat ctccaagcac aacaacaaca acaacaacca aaccttggaa tactctcaag      1800
     gttcggggac ggagcagaag tgaagtaccc agagcaccag gtttgtttga actcatgaca      1860
     acccatggcg gaccgccagt tcccaatatc agctacacaa gtgagcccgt ggaaaataaa      1920
     gaggccaagc atgcgcggcc acaacatgat gctgccgagg aagatgatga cgatgatagc      1980
     gaagaaaagc ttattatgga atttccaatt ccgaaggaac taccgatacc gacactggaa      2040
     ggattcaaga cacagattct ccggctcaac ccccgtatcg aaccggcttt gattgatcga      2100
     tttgcacacg agcaggtccg acgatacaag aggttgatcg agatcaagca aacacacgca      2160
     cgcgatgtca accacaggaa gtgcaaggct ggtaaattct gcttcgccct gggcggtaca      2220
     gcgaaacttt taccaccacg cttatcagct caggatggag attcgcacac ccagttccag      2280
     attcctaggc cgggagagga ggaagagagc tccgaagatc ttggggaaac caccatgtta      2340
     gcccatttcc cgcaaggcgt tccgcatcca ccaccacagg tcaagctact gccggctgaa      2400
     tttgaatgta tggtttgcta ccatgtcaag aaattccaga aaccgtcgga ctggacgaag      2460
     catatctatg aagatgtgca accattcact tgcacgtttc ccgactgcac cgatcccaag      2520
     tccttcaaac gaaaagctga ctgggttcgg catgagagcg aacggcaccg gcagctcgaa      2580
     tggtgggaat gctcgctcgc tgattgtcgc cacaagtgtt atcgcaaaga caacttcgtg      2640
     cagcacctcg ttcgagaaca caagatgcca gaaccaaaag tcaaaaaacc aagaaacagg      2700
     gagttgtcag acggggcgtc gaacgaccca acttcccttg aggtgcagga ggagatcaac      2760
     cgtgagcgag agatcaatgg cctgtggaag cttgtggaga gctgtcattt cgagactgcg      2820
     agaaatcccc gcgaggagcc ttgccggttt tgcggcaatg tttgcaccaa ttggaaaaag      2880
     ctcacggtac atctggcaaa acacatggag caattggcta taccaatcct gggtctcgtg      2940
     aaagaaagag atttcccgta caccgtcaat atcggctcga gtggcaaccc agataatttc      3000
     tctggtcaag tgccgatcgc ccagaaagac agcgattttg atccaagatt agacactgga      3060
     gttaccgagg ggcctggaac tgcggacaat ttcacgcagg caccgtattc gaatagccat      3120
     ccagggtctt ccgaaccgat tatgttaccg ttcaatacgg gcgcatcgta cctccctaac      3180
     gcctctatgc ctttggatag tacagcaccc aacccggcag ctcgtttcga aggagtcacg      3240
     ccgtacacag cacatggcgg aggcgtggct ggactcgctg gggaccagac acggttaatg      3300
     gccatgcacc agcatcagaa ttcagtcacc taccctccat tcaacgccag gccgcgacta      3360
     actgtcccca atcaagacat gagggtgctg ccggaatata acagtttctc catgtccccc      3420
     acggagatgc agtacgatcc acaaaccacg gcgtacgtgt ccagcggagc ggagaaccac      3480
     tatccttacc aaggaccaat agcttcggct atgccttacg attcagggta ccaaggccaa      3540
     tga                                                                    3543
//

If you have problems or comments...

PBIL Back to PBIL home page