(data stored in ACNUC16935 zone)

EMBL: BN001307.PE265

BN001307.PE265       Location/Qualifiers
FT   CDS_pept        join(731420..731781,731892..732101,732157..732763)
FT                   /locus_tag="ANIA_01438"
FT                   /old_locus_tag="AN1438.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G04290)"
FT                   /note="transcript_id=CADANIAT00008051"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008051"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008051"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM53"
FT                   /protein_id="CBF84858.1"
FT                   /translation="MVQELGEFDRRCSASHYSEPSETGSQYNGLHSSDSGYSTRSCTTR
FT                   SIATSYAVGSACSPRLTPQEYEHGEKTAPVGAELAHHYEPMDIVGPPESPSIFGHEVIK
FT                   CDYPKCPWTGKCPSDKRRKEGFGTINDLARHKKCVHKKEPERGPKVLYMCFGRNCPRSS
FT                   KKWPRLDNFRQHLARMHNNEDADELLRRSREWYENLKSKDTVSIHTDNMPEQATLSQVR
FT                   PESGIMVQSASNDLQDPLAAIHTAFQAANSSMLSLDPVREHSMLDIDHTRAIELAELKL
FT                   GPALEQNPSQPANPRHDKMDNMISEAAVSVINAMTKMINNHQRRRGHLGEDDITEQDGE
FT                   LSDRNRDILQKILVTASELLSGSPGPGNSNPLEKTSNRSDRASWSQCEFCPE"
     atggttcaag agctgggcga gtttgatcgt aggtgttctg ctagccatta tagcgaaccc        60
     tctgagactg gaagtcagta caatggccta cactcgtccg actctggata cagcactcgc       120
     agttgcacga cacggtccat cgctacctca tatgctgtag gttctgcttg cagtccgcgc       180
     cttaccccgc aagagtacga acatggcgag aaaacggcgc cggtaggcgc cgagttagcg       240
     catcattatg aacctatgga tattgtcggt ccaccagagt cgccgtctat atttggtcat       300
     gaagtgatca aatgcgacta cccaaaatgt ccgtggactg gcaagtgtcc gtctgataaa       360
     agacgcaagg aagggtttgg caccatcaat gatcttgcac ggcataagaa atgcgttcat       420
     aagaaggagc cggagcgtgg gcccaaggta ttatatatgt gctttggacg gaactgccca       480
     cgaagcagta agaagtggcc ccgcctggac aatttccgtc aacaccttgc tcgcatgcat       540
     aataatgaag acgccgatga actgctgagg aggtctcgtg agtggtacga aaacctaaag       600
     tcaaaggata ctgtatctat acatacggac aacatgcctg aacaggcaac actgtcacaa       660
     gtccgacccg aatcaggaat catggttcaa tccgctagca atgacctcca agatccgctt       720
     gccgcgatcc atacagcttt ccaggccgcc aactcgagca tgttatcgtt agacccagtc       780
     agagagcaca gcatgctcga catcgatcat actcgggcca ttgagctggc agaattgaag       840
     ctggggccag cgttggagca gaatccttcc cagcctgcca atccacggca tgataaaatg       900
     gacaatatga tatctgaagc ggcggtgagt gtgataaatg ctatgacgaa aatgatcaac       960
     aatcatcagc ggagacgtgg ccacctgggg gaagacgata taaccgaaca ggatggcgaa      1020
     ttatcagatc ggaaccgaga catcctgcag aagatcttgg ttacggcatc ggagctgcta      1080
     tcggggagtc caggaccagg aaatagcaat cccctcgaga agactagtaa caggtcggac      1140
     agggcgagct ggagtcaatg tgagttttgt ccagaataa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page