(data stored in ACNUC16935 zone)

EMBL: BN001307.PE266

BN001307.PE266       Location/Qualifiers
FT   CDS_pept        complement(join(733895..733953,734007..734133,
FT                   734197..734334))
FT                   /locus_tag="ANIA_01439"
FT                   /old_locus_tag="AN1439.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008052"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008052"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008052"
FT                   /db_xref="GOA:Q5BDE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE1"
FT                   /protein_id="CBF84860.1"
FT                   /translation="MPPRLNFNCSRALFRRNLTTTRTRLNTGMPPHPPTQQPETSAYKE
FT                   GMSRYKVFASPFAKVFLGAVFTYQVIYWTWVKLEMEEVKVEKNQQLAALETEARELTGT
FT                   GKK"
     atgcctcctc gtctcaactt caattgctct cgggcgcttt tccgcagaaa cttaacaacc        60
     acccgcaccc gactgaacac cggtatgccg ccgcatccac caacccagca accagaaaca       120
     agtgcctaca aggaaggaat gtcgcgctac aaagtcttcg ccagcccgtt tgcaaaggtc       180
     ttcctgggcg ccgtcttcac gtaccaggtt atatactgga cctgggtgaa gttggagatg       240
     gaggaggtca aggttgagaa gaaccagcaa ctcgctgcct tggagacgga ggcaagagag       300
     ctgaccggga ctgggaagaa atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page