(data stored in ACNUC16935 zone)

EMBL: BN001307.PE268

BN001307.PE268       Location/Qualifiers
FT   CDS_pept        join(740982..741245,741398..741889)
FT                   /locus_tag="ANIA_10204"
FT                   /old_locus_tag="AN10204.4"
FT                   /product="nucleoside-diphosphate-sugar epimerase family
FT                   protein (AFU_orthologue; AFUA_6G11740)"
FT                   /note="transcript_id=CADANIAT00008054"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008054"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008054"
FT                   /db_xref="GOA:C8VM56"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM56"
FT                   /protein_id="CBF84864.1"
FT                   /translation="MFYTIPEYSRRSWLFMTAVTNQLIPLPRNASFEILAATRNSQSPS
FT                   AQSLSRLSSNIKLVEVNLDDPAAIFHNAHRAEQIPIWGVFSVQTSVDRGGEAKSPNNPT
FT                   RIPHFIHKHNIEHHLIQQAKVNDMQWLILRPTAFYENLVPRFFGIIFATCFKMALKGKP
FT                   LQLVATSGIGYFAAEGFLNPKKYAGRGLSLAGDELTYDQFVEIFEQKTEQTIPSTFRPL
FT                   CSLLLTLIKDMGYMFKWFMTKGTGRILLS"
     atgttctata ctattcctga gtatagtcga cgctcatggc tttttatgac tgccgtgact        60
     aatcagttaa tcccgctccc taggaacgct tcctttgaga tccttgccgc cacccgcaac       120
     tcgcaatcgc cctcggccca gagtctctct aggctatcgt caaacatcaa actggtggaa       180
     gtaaatctgg acgacccagc agcaatattt cataacgcac accgcgctga acagataccc       240
     atttggggtg tcttcagtgt ccagacctcc gttgatagag gcggcgaggc aaagtcgcct       300
     aacaacccta cccgcatccc gcactttatt cacaagcata acatcgagca ccacctcata       360
     cagcaggcca aggtgaatga tatgcagtgg ctcatcctcc gccctaccgc gttctacgaa       420
     aaccttgtcc cccgcttctt tggcataatc tttgcgacct gcttcaagat ggcgctgaag       480
     ggaaagcctc tacagctagt ggctaccagc ggcattggat actttgctgc tgaggggttt       540
     ctgaacccca agaaatacgc gggtaggggg ctgtctctcg cgggtgacga gttgacctat       600
     gatcagtttg tggagatttt tgagcaaaag accgagcaga cgattccatc gacatttcgg       660
     ccgctctgct cacttttgct gactctgata aaggatatgg gctatatgtt caagtggttt       720
     atgacgaagg gtacggggcg gatattgcta agttga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page