(data stored in ACNUC16935 zone)

EMBL: BN001307.PE27

BN001307.PE27        Location/Qualifiers
FT   CDS_pept        complement(join(73021..74557,74645..75288))
FT                   /locus_tag="ANIA_09035"
FT                   /old_locus_tag="AN9035.4"
FT                   /product="Putative alpha-galactosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARP5]"
FT                   /note="transcript_id=CADANIAT00007818"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007818"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007818"
FT                   /db_xref="GOA:Q5ARP5"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ARP5"
FT                   /protein_id="CBF84419.1"
FT                   /translation="MTNSKARYVLEPVQVTGTTFALNGTTLSYQFHVDEPSADLRSDHF
FT                   GGSISGPIPVDPEPIVDGWTGMPDRVRREFPDQGRGDFRVPAFRIRQAEGHTVSAFRYR
FT                   EHEIVPGKEVSASGLPGVFGDAHDATTLIVRLVDPYSDLAAELKYTVFPKYDTVVRSAS
FT                   ITNKSNSDVTIESLASLSVDFPFDELEMIGLRGDWAREAHRLRRKVDYGVQSFGSTTGF
FT                   SSHLHNPFVALVHPSTTESQGEAWGFSLIYSGSFTINVEKSSQGLTRVSIGPSQLSWTL
FT                   KPGETFDSPECVAVYSSTGIGGMSRSLHGLYRKHLMKSKFATEDRPVLLNSWEGLYFHI
FT                   DQDRMYRLAQEAAALGVKLLVMDDGWFGDEHPRTSDDAGLGDWIPNPARFPDGLTPLVN
FT                   RITALKVANSQRNMRFGIWVEPEMVNPRSTLYQQHPDWVLHAGNYPRTEQRNQLVLNMS
FT                   LPEVQEFIISAMSEILNAADITYVKWDHNRGLAETPSPCANHAYMLGAYRVFDVLTTRF
FT                   PNVIWEGCASGGGRFDPGILQYFPQVWTSDDSDAVERIFIQFGTSLAYPASAMGGHISS
FT                   VPNHQTGRTTPLTFRAHVAMMCGSFGLELDPAHLTDSERRDIPGLIALAEKISPIVVKG
FT                   DLWRLALPEDSNWPAALFLSENRTQGVLFFFQLAPMVNHSLPRVRLQGLEDGALYRVDG
FT                   EGPYSGSMLMNLGLQYSFRGDYGSRLAFIERE"
     atgaccaatt ccaaagccag atatgtctta gagccagtgc aggtcactgg cacaactttt        60
     gccctcaacg gtaccacact ctcctaccag ttccacgtcg atgagccctc cgccgacttg       120
     cggtccgacc atttcggcgg ctcaatcagc ggccctatcc ccgtcgatcc tgagcccatc       180
     gttgatgggt ggacagggat gccagaccgc gtacggcgcg agttccctga tcaaggcaga       240
     ggagactttc gggtacctgc gtttaggatc cggcaggctg aagggcatac agtctcggcg       300
     tttcggtatc gggagcatga aatcgttcca ggaaaggaag tctctgcgtc tggactacca       360
     ggggtctttg gggatgctca tgatgcgacc acgctaattg tacggttggt tgatccatat       420
     agcgacttgg ccgcggagtt gaagtatacg gtctttccga agtatgatac cgtggtacgc       480
     agtgcaagta tcacgaataa gagcaatagt gacgtaacaa tcgagtcgct tgcaagtctc       540
     agtgttgatt ttccttttga cgaactcgag atgatcggac tacgaggcga ctgggcgaga       600
     gaggctcatc gtctgcggcg caaggtggac tacggggtac agagttttgg cagcacaacc       660
     ggattctcct cgcatctgca taacccgttc gtcgctcttg tgcacccgtc caccaccgaa       720
     tcacaaggtg aagcatgggg gttctcgctc atctacagcg gatctttcac tatcaatgtc       780
     gagaaatcct cgcaagggct gacgcgcgtc tccatcggac cgagccaact gtcttggact       840
     ctcaaacctg gtgagacatt tgactcgccc gagtgtgttg ctgtctactc cagcactggg       900
     attggaggga tgtcccgttc tctccatggg ctgtatcgga aacacctaat gaagagcaag       960
     ttcgcgaccg aagaccgccc cgtgctcttg aatagctggg aggggctgta ttttcatatc      1020
     gaccaggacc ggatgtaccg tctcgcacag gaggcggcgg cgttgggcgt caagctgctc      1080
     gtcatggatg acggctggtt tggggacgag catccgcgga cctctgatga tgccggcttg      1140
     ggcgattgga tccccaatcc ggccagattc cctgacgggc tgacgccgtt agtgaacagg      1200
     atcactgcgt taaaggtcgc gaattcgcag agaaacatgc gcttcgggat ctgggttgag      1260
     ccagagatgg tcaaccctcg atccacgctc taccagcaac accccgactg ggttcttcat      1320
     gctggcaatt atccacgcac tgagcagcgc aatcagcttg tgctcaatat gagtctgccg      1380
     gaggtgcagg agttcattat cagcgcgatg tcggagatcc taaacgccgc tgacattaca      1440
     tatgtcaagt gggaccacaa ccgcggcctc gcagagacac catctccatg cgcaaaccac      1500
     gcctatatgc taggcgccta ccgcgtgttt gatgtcctca ccacccgctt tcctaatgtc      1560
     atctgggagg gctgcgcatc gggcgggggc cgcttcgacc caggaatcct gcagtacttc      1620
     ccacaagtat ggacatccga cgacagcgac gcggtcgagc ggatcttcat ccagttcggt      1680
     acctctcttg catacccggc cagcgcaatg ggggggcata tatcgtccgt gccaaatcac      1740
     cagaccggcc gcaccacacc gctgaccttc cgcgcccacg tcgccatgat gtgcggctcc      1800
     ttcggcctag aactcgaccc agcccacttg accgattccg aaagaagaga cattcccggc      1860
     ttgattgctt tagcggaaaa gatcagcccg attgtggtta agggcgactt gtggcggtta      1920
     gctttaccgg aggattcgaa ctggccagcg gcgctgttcc tttccgagaa ccggacacag      1980
     ggcgtgttgt tcttcttcca attggcgcca atggtcaacc attccttgcc acgggtgaga      2040
     ttgcagggtt tagaggacgg ggcgctgtat cgggttgatg gagaggggcc gtattccggg      2100
     tcgatgctga tgaatctggg gttgcagtat tcgttcaggg gtgattatgg tagtagactt      2160
     gccttcatag agagagagta a                                                2181
//

If you have problems or comments...

PBIL Back to PBIL home page