(data stored in ACNUC16935 zone)

EMBL: BN001307.PE270

BN001307.PE270       Location/Qualifiers
FT   CDS_pept        join(745221..745320,745386..745690,745763..746176)
FT                   /locus_tag="ANIA_01442"
FT                   /old_locus_tag="AN1442.4"
FT                   /product="translocation protein (Sec66), putative
FT                   (AFU_orthologue; AFUA_8G04260)"
FT                   /note="transcript_id=CADANIAT00008055"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008055"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008055"
FT                   /db_xref="GOA:Q5BDD8"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD8"
FT                   /protein_id="CBF84867.1"
FT                   /translation="MVDWVTLIVPFAYLSVLIGSLATFSSLYRKRKARKATSLEPWFPS
FT                   HLQRDIYFSLLHLDPPASATEKKVAVPESVLKAALLRRAQEDIRRVMTLRSQKQALSVL
FT                   LQRGSVGDDLWQRFLRAEKEMEDEVRDVVTEANAYAPNWGQVIFQSANEMVNNEIVRER
FT                   LDKHQKKLDEEKAWWEKKKASIQEGFMKELDAEKPGTVTTAAAATAAPEVAEGTQVAVG
FT                   SKASASAAAPPAPTVTESDDDAVLVEADDQAGSAGQKSPGGGKKKKKGKK"
     atggtggact gggtcacact tattgtaccg tttgcgtacc tcagcgttct aatcggctcc        60
     cttgcaactt tctcatccct ctaccgcaag cgcaaggcca gaaaggccac atccctagaa       120
     ccatggtttc cgtcacatct acaacgagac atctactttt cccttctgca ccttgacccg       180
     cccgcctcag caacagagaa gaaggtcgcg gtccccgagt cggtcctcaa ggcggcgcta       240
     ctccgccgcg ctcaagaaga cattcgccgc gtcatgaccc ttcgcagtca gaagcaggct       300
     ctttccgtac ttcttcagcg gggaagtgtg ggcgacgacc tttggcagag gtttctgcgg       360
     gcggagaagg agatggagga tgaagtgcgg gatgttgtta ctgaggcaaa cgcgtacgcc       420
     cccaactggg gccaggtaat cttccagtcg gcaaacgaaa tggttaacaa cgagattgta       480
     cgcgagcggt tagataaaca ccagaagaaa cttgatgagg agaaggcttg gtgggagaag       540
     aagaaggcta gtatccagga agggttcatg aaggagctgg atgctgagaa gccgggcacc       600
     gtcactactg ctgctgctgc taccgcggcg cctgaggttg ctgaaggtac gcaggttgca       660
     gttgggtcga aggcatctgc ttcagctgcg gctccccccg caccgactgt tacggagagt       720
     gacgatgatg cggtgcttgt agaggctgat gaccaggccg ggagcgcagg acaaaagagt       780
     cctggtggag gaaaaaagaa gaagaagggg aagaaatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page