(data stored in ACNUC16935 zone)

EMBL: BN001307.PE271

BN001307.PE271       Location/Qualifiers
FT   CDS_pept        complement(join(746827..747790,748016..750981))
FT                   /locus_tag="ANIA_01443"
FT                   /old_locus_tag="AN1443.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008056"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008056"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008056"
FT                   /db_xref="GOA:Q5BDD7"
FT                   /db_xref="InterPro:IPR038799"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD7"
FT                   /protein_id="CBF84868.1"
FT                   /translation="MAKSGKKNKKGVKKGKSQEDAPAPQPEVPSTEPEQQQPAADTPQP
FT                   EVPSTGPEQQQLAADTPQPEEAPELPTASTTGEEPNPLAKSEVTTQVVPEIVPDLKPVL
FT                   ESAPEREPEPEQTQNIEQSQTPSDPDIPSQTPLEDNDFTEITKHDTSSNQPPGMIDTQI
FT                   EHIQEPSHDDLGVWEQLDTAEAEKNHDDTPIEQSNSVDQSEQSPITAPQSPTFTFAPET
FT                   STTEPTETWSAWEENDLTKASPAEEETATPKNDDHNSHVFTNPSGEIASTEPASESAQT
FT                   SDLAPAPASQPEVELPLESELAKEAEPIQKPEPVKEPEPAAEPETFFSEPVEPIEVPEP
FT                   VQKPETATSPEPVREPEPVQEPEVAITPEPVEEPEPVQVPEAVTAPESAIEPEPLATVE
FT                   PAMGAEHTMEPAQEVTPPASKPQSPAPATASPSYKSASPMQRAVSPAAISVADTVDAPH
FT                   AFPPPPAAPTPPPASPKTQDVPPLKDASYPTPRAAPPTPPSASPQYNSSYPTDQAYSPR
FT                   QKSSPSHNTRKPSSPIPKISSPLAHAYTSPVMSPHTTSVPPMPPSFPPSVSHSYATAYQ
FT                   SPAMSTAGYFPPQYGYYQPTSHPHHTPRGPMAPNGPYPGLRDPGYPNEHDRSGRGGPMV
FT                   PPDQEDARELLDRIQDAIPDINRLLGSYKHTKTKLQSREAEFKQMESQHKQALMHKDFF
FT                   IEALQNQLRKTANESAEEATKLKNMINELRMELGNMEEKRKDMEEKLADSEASISSLEE
FT                   KKTGLEEQIKKLNEQIEEERVAHSQELDRQRAEMEAEKEEALKTQKQELTELFEEIKAE
FT                   DEKAAAEALAAREAELLEQQEAMKIEYEQQKQQMQNSHDTLQAEFDTKLAELATTQGDL
FT                   EKKHQELEDTRHAHVEQVESLENQHQEKITEMERAWTEEKTGLETQLSEKSEELANSER
FT                   ENKRLEEDLLSKEKQLQLSVDNMRLTINNLDNDCDRLRKTLHSLGEATDLKNTKGDTFF
FT                   LDCFGQLQRLIVTLSKEHFSYLPIDPPQEVLSKLPPELPSFLDNTPASRELRSAYVQHV
FT                   VSKILTYRIFHPFLFTLGRRYDKADILFQMLSMDIRRKSVRREAFWRQQTLKAAYTTSD
FT                   AKESINVVAAVIVDEISNSLKHFADPRRMDGLLTSIRKIVKLAAETWRHARVERELIIA
FT                   ALPAPEDGSVPGEDWEEYGVPKENSSGRTSPKTADFARHVVLRPFPRIIREAAHEDFLG
FT                   DEGKASPCTYSRGSVLYSDSPIILARLQELAGKTTDAPVRREDSPPATGRLSRASTYYE
FT                   PPSPRIPYAQDTLIEGATGPNFGTA"
     atggccaagt caggcaagaa gaataagaaa ggcgttaaaa agggcaagag ccaggaggat        60
     gctccagctc ctcagcctga agttccctct accgagcctg agcagcaaca accagcagca       120
     gacacacctc aacctgaggt tccctctact gggcctgagc agcaacaact agcagcagac       180
     acacctcaac ctgaagaggc gcctgagctg ccaactgctt ctacgacagg agaggagcct       240
     aaccccctcg ctaaatcaga ggttacgacc caggttgtcc cagagatagt accagatctc       300
     aaaccggtac ttgagtctgc gccggaaaga gaaccagagc cagagcaaac gcagaacatc       360
     gagcaatccc agacgccgtc tgacccggac attccttctc aaacaccgct cgaagacaat       420
     gatttcactg aaataaccaa acacgacact tcgtcaaatc aacctcccgg tatgatcgat       480
     acccagattg agcacatcca ggaacctagc cacgacgatc taggcgtatg ggaacaactc       540
     gacacagctg aagcagaaaa aaaccacgac gacactccga tcgaacagag caactctgtg       600
     gaccaatccg aacaatcgcc aatcaccgcg ccgcaatcgc ctacgttcac atttgcgccg       660
     gagacttcga cgaccgaacc taccgaaact tggtcagctt gggaggaaaa cgatttgact       720
     aaggcttcac ctgctgaaga agagactgcc accccgaaga acgacgatca taattctcac       780
     gttttcacga atccttctgg cgagattgct tcaacagagc cagcctctga atctgctcag       840
     acttctgacc ttgcgcccgc ccctgcttct caaccagaag tcgaacttcc cctcgaatct       900
     gagcttgcta aggaagcaga acccattcag aagccagagc ctgttaaaga gccagagccg       960
     gccgcagagc ctgagacttt tttctctgaa cctgttgaac ctatcgaagt acccgagcca      1020
     gttcaaaagc ctgagactgc tacatcgcct gaacctgtta gagaacccga gccagttcag      1080
     gagcctgagg ttgctataac gcctgaacct gttgaagaac ccgaaccagt ccaggtgcct      1140
     gaggctgtta cagcgcctga gtctgcgatc gaacccgagc cgctagctac agtcgagccc      1200
     gcgatgggag ctgaacacac catggagccg gcacaagaag tcactccgcc tgcatcgaaa      1260
     ccccaatccc ctgcaccagc aactgcttca ccgtcctaca agtcggcttc acctatgcaa      1320
     cgcgcagttt cgcctgctgc gataagtgtc gccgacaccg tcgacgcgcc acacgctttc      1380
     cctcccccgc ctgctgctcc tacaccacca ccagcatctc ctaagacaca ggatgttcca      1440
     ccgttgaaag atgcatcata tcccactcca agagcggcac caccaacgcc gcctagtgcc      1500
     tctcctcagt acaactcatc gtaccctaca gaccaggctt actcaccgcg gcaaaagtca      1560
     tcaccgtcgc ataacactcg caagccctcc tcgcctattc ccaaaatcag cagtcctctg      1620
     gcacatgctt acacctctcc ggtgatgtct ccacatacta cgtctgttcc gccaatgcct      1680
     ccttcttttc ctccatctgt ctcccacagt tacgccactg cttatcagtc gcccgctatg      1740
     agcactgctg ggtactttcc tcctcagtac ggctactatc aaccaacttc gcatccacac      1800
     catactcccc gaggacccat ggccccaaat ggtccgtacc caggtttgag agatccgggc      1860
     tatcccaacg agcatgatcg ctccggacga ggagggccta tggtacctcc tgatcaagaa      1920
     gatgcacggg agcttctaga tagaattcag gacgcgatcc cggatattaa ccgccttctc      1980
     ggatcgtaca agcatacaaa gaccaaactt cagtcccgag aagccgagtt taagcaaatg      2040
     gagagccaac acaaacaagc gttgatgcat aaggatttct tcatcgaggc gctccagaac      2100
     cagctgcgga agactgcgaa cgaaagtgct gaggaagcca caaagctgaa aaacatgatc      2160
     aacgaattgc gaatggagct tggcaacatg gaggagaagc ggaaggatat ggaggaaaag      2220
     ctcgctgact ccgaagcctc catttcctct ctggaggaaa agaaaaccgg actcgaagag      2280
     cagatcaaaa agctgaacga gcaaattgag gaagaacgcg tagcccatag ccaggaattg      2340
     gacaggcaac gagcagagat ggaagcagaa aaagaagaag ctctcaagac gcagaagcaa      2400
     gagctaactg aactctttga ggagatcaag gctgaagacg agaaagcagc ggcagaggct      2460
     ttggcggctc gtgaagctga attgctcgag caacaagagg caatgaagat cgagtacgaa      2520
     cagcagaaac agcagatgca aaactcgcat gataccctgc aggccgagtt cgacactaag      2580
     ctggcggaac ttgcaactac ccagggtgat cttgagaaga agcaccagga attggaagac      2640
     actcgacatg cgcacgttga gcaggttgaa tcacttgaga accagcacca agagaaaatt      2700
     accgagatgg aacgagcttg gactgaggag aagacgggcc tggagactca gctttctgag      2760
     aaatccgaag agcttgccaa cagcgagcga gagaacaaac gactagagga ggatctcctt      2820
     tccaaggaga aacaactcca gctttcggtg gacaacatgc gtcttactat taacaatttg      2880
     gacaacgact gcgacagatt gaggaaaact ctccacagtc ttggagaagc cactgacctc      2940
     aagaacacaa aaggcgatac attctttctg gactgcttcg gccaacttca acgtctcatc      3000
     gtgacgctct ctaaggaaca cttttcgtat ctaccaattg accctcctca agaggtcctt      3060
     tccaagctcc cgccagagct tccttcgttc cttgacaaca ccccagcgtc tcgcgaactc      3120
     cgctccgctt acgtccagca cgtcgtttcc aaaatcctaa cctaccgcat cttccacccc      3180
     tttctcttca ctctcgggcg ccgctacgac aaagcagaca tcctcttcca gatgctctca      3240
     atggacattc gccgcaagtc cgttcgtcgc gaagctttct ggcgccagca aaccctcaaa      3300
     gcagcctaca ccacctctga cgcaaaggag tccatcaacg ttgtcgccgc cgtgatcgtg      3360
     gacgagatca gcaacagcct caagcacttt gctgacccgc gccgtatgga tggccttctc      3420
     acaagcatcc gcaaaattgt caaacttgcc gccgaaacat ggcgacacgc acgagtcgag      3480
     cgcgaactca tcatcgctgc ccttccagcc cccgaagacg gcagtgtccc cggtgaggac      3540
     tgggaagagt acggcgttcc caaagagaat tcctcgggtc gaacctctcc gaagacagca      3600
     gattttgccc gccatgtggt cttgcgtccc ttccctcgca ttatccgcga agcagcccac      3660
     gaggactttt taggtgacga gggcaaggcg agcccgtgta cgtactctcg tggctccgtc      3720
     ctgtactctg actcgccaat tattcttgca agactccagg aattggcggg aaagactaca      3780
     gatgcacctg tgcgaagaga ggattcgcct ccggcgacag ggagactctc gcgagcatcg      3840
     acttattatg aacccccttc gcctcggata ccgtatgccc aggataccct tattgagggt      3900
     gcaacaggac ctaactttgg aaccgcttag                                       3930
//

If you have problems or comments...

PBIL Back to PBIL home page